DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Pdcd1lg2

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001101052.2 Gene:Pdcd1lg2 / 309304 RGDID:1306403 Length:268 Species:Rattus norvegicus


Alignment Length:163 Identity:42/163 - (25%)
Similarity:66/163 - (40%) Gaps:15/163 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 TVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYN----DHRSWYLHIK 144
            ||..|....:.|..:..:..::..:|...|   .:.::..||:.|.:|...    ...|:  ||.
  Rat    31 TVDFGSSVSLECDFDRRECTELEGIRASLQ---KVENDTSSQSQRATLLEELLPLGKASF--HIP 90

  Fly   145 EVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPYV 209
            .|:..|.|.|.|.|........| ||.|.|....|. :.:..:.|.....:.|:|:|||||...|
  Rat    91 SVQVRDSGQYRCLVICGAAWDYK-YLTVKV
KASYVR-IDTGILEVPGTGEVQLICQARGYPLAEV 153

  Fly   210 MWRREDGEEMLIGGEHVNVVDGELLHITKVSRL 242
            .|:   ...:.....|:...:| |..:|.|.||
  Rat   154 SWQ---NVSVPANTSHIRTPEG-LYQVTSVLRL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 22/91 (24%)
IG_like 82..174 CDD:214653 23/93 (25%)
IG_like 184..267 CDD:214653 17/59 (29%)
IGc2 191..255 CDD:197706 16/52 (31%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
Pdcd1lg2NP_001101052.2 IG_like 28..119 CDD:214653 23/93 (25%)
Ig 137..193 CDD:299845 16/50 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.