DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Iglon5

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001419161.1 Gene:Iglon5 / 308557 RGDID:1305344 Length:336 Species:Rattus norvegicus


Alignment Length:392 Identity:112/392 - (28%)
Similarity:165/392 - (42%) Gaps:75/392 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LPRPHTRRRFRLQAEFNVRQLAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDF 73
            :|.|....|.||        ||...:|..||.             |:|    |.:|..       
  Rat     1 MPPPAPGARLRL--------LAAAALAGLAVI-------------SRG----LLSQSL------- 33

  Fly    74 PRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRS 138
             .|:.|..|.||..|.:|.::|.::. ...:|||  ::...||...::..:.:.|:.|..|....
  Rat    34 -EFSSPADNYTVCEGDNATLSCFIDE-HVTRVAW--LNRSNILYAGNDRWTSDPRVRLLINTPEE 94

  Fly   139 WYLHIKEVEETDRGWYMCQVNT--DPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKA 201
            :.:.|.:|...|.|.|.|...|  .|..::. ||.|.||..||.  .|:.:.|.||.|::|:|.|
  Rat    95 FSILITQVGLGDEGLYTCSFQTRHQPYTTQV-YLIVHVPARIVN--ISSPVAVNEGGNVNLLCLA 156

  Fly   202 RGYPEPYVMWRR-EDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGV--PPSISKRV 263
            .|.|||.|.||: .||          ...:||:|.|:.:.|.....|.||..|||  .|. |:||
  Rat   157 VGRPEPTVTWRQLRDG----------FTSEGEILEISDIQRGQAGEYECVTHNGVNSAPD-SRRV 210

  Fly   264 HLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYETTST 328
            .:.|.:||.::.......| ||:..:|.|...|.|.:...|  .:.|.::|..|..|.|.:|..|
  Rat   211 LVTVNYPPTITDVTSARTA-LGRAALLRCEAMAVPPADFQW--YKDDRLLSSGSAEGLKVQTERT 272

  Fly   329 VSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKL----------DEMPTPTTAIISEMS 383
            .|      .|....|....:|.|.|.|.|.||.:..:::|          ...|.|.| ::|.:|
  Rat   273 RS------MLLFANVSARHYGNYTCRAANRLGASSASMRLLRPGSLENSAPRPPGPLT-LLSALS 330

  Fly   384 LL 385
            .|
  Rat   331 WL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 25/93 (27%)
Ig strand B 91..95 CDD:409353 1/3 (33%)
Ig strand C 104..108 CDD:409353 2/3 (67%)
Ig strand E 139..143 CDD:409353 0/3 (0%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 0/2 (0%)
Ig 176..267 CDD:472250 34/93 (37%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 2/3 (67%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 1/2 (50%)
IG_like 282..368 CDD:214653 25/85 (29%)
Ig strand B 288..292 CDD:409353 1/3 (33%)
Ig strand C 301..305 CDD:409353 0/3 (0%)
Ig strand E 330..340 CDD:409353 2/9 (22%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
Iglon5NP_001419161.1 Ig 41..129 CDD:472250 24/91 (26%)
Ig strand B 50..54 CDD:409382 1/3 (33%)
Ig strand C 62..66 CDD:409382 3/5 (60%)
Ig strand E 95..99 CDD:409382 0/3 (0%)
Ig strand F 109..114 CDD:409382 2/4 (50%)
Ig strand G 122..125 CDD:409382 0/2 (0%)
Ig_3 134..199 CDD:464046 27/76 (36%)
Ig_3 217..295 CDD:464046 24/86 (28%)

Return to query results.
Submit another query.