DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Btn2a2

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_038952161.1 Gene:Btn2a2 / 306957 RGDID:1306973 Length:555 Species:Rattus norvegicus


Alignment Length:179 Identity:41/179 - (22%)
Similarity:67/179 - (37%) Gaps:28/179 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 AEPIANVTVSVGRDALMACVV---ENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRS 138
            ||||   ...||.:..:.|.:   .|.:..:|.|.|......:.::.....:.....:.|....:
  Rat    37 AEPI---LAMVGENITLHCHLTPERNAEDMEVRWFRWRFSPAVLVYRGHQERPEEQMVPYQGRTT 98

  Fly   139 WY----------LHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMV---VR 190
            :.          |.|..|...|.|.|.|.     .:..:.|.|..: .:.|..|.|..::   ..
  Rat    99 FMSTDISKGRVALIIHNVTTYDNGIYYCY-----FQEGRSYDQATI-RLRVASLGSEPLIQMKTL 157

  Fly   191 EGQNISLVCKARG-YPEPYVMWRREDGEEMLIGGEHVNVVDGE-LLHIT 237
            |..:|.|.|.:.| ||||..:| |:..:|::...|.....|.| |..:|
  Rat   158 EDGSILLKCTSGGWYPEPRAVW-RDPYDEVVPALEEEYTADREGLFRVT 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 17/104 (16%)
IG_like 82..174 CDD:214653 17/104 (16%)
IG_like 184..267 CDD:214653 18/59 (31%)
IGc2 191..255 CDD:197706 17/49 (35%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
Btn2a2XP_038952161.1 IgV_MOG_like 31..144 CDD:409378 21/115 (18%)
Ig strand B 48..52 CDD:409378 0/3 (0%)
Ig strand C 64..68 CDD:409378 1/3 (33%)
Ig strand E 109..113 CDD:409378 1/3 (33%)
Ig strand F 123..128 CDD:409378 2/9 (22%)
Ig strand G 136..139 CDD:409378 1/2 (50%)
SPRY_PRY_BTN1_2 344..514 CDD:293991
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.