DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Lsamp

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001401926.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus


Alignment Length:313 Identity:105/313 - (33%)
Similarity:149/313 - (47%) Gaps:42/313 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DFPRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDH 136
            ||.|..:   |:||..|..|::.||||: |..||||  ::...|:...|:..|.:.|:.|.....
  Rat    50 DFNRGTD---NITVRQGDTAILRCVVED-KNSKVAW--LNRSGIIFAGHDKWSLDPRVELEKRHA 108

  Fly   137 RSWYLHIKEVEETDRGWYMCQVNT--DPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVC 199
            ..:.|.|::|:..|.|.|.|.|.|  :|..|:. ||.|.|||.|..  .|:|:.|.||.|::|||
  Rat   109 LEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQV-YLIVQVPPKISN--ISSDVTVNEGSNVTLVC 170

  Fly   200 KARGYPEPYVMWR------RE-DGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPP 257
            .|.|.|||.:.||      || :|||             |.|.|..::|.....|.|.|:|.|..
  Rat   171 MANGRPEPVITWRHLTPLGREFEGEE-------------EYLEILGITREQSGKYECKAANEVSS 222

  Fly   258 SISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDK 322
            :..|:|.:.|.:||.::.....| |..|:...|:|...|.||....|  .|.|..|:  |..|.:
  Rat   223 ADVKQVKVTVNYPPTITESKSNE-ATTGRQASLKCEASAVPAPDFEW--YRDDTRIN--SANGLE 282

  Fly   323 YETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDEMPTPT 375
            .::|...|..|      :..|....:|.|.|||.|.||.|:.::.|.:...||
  Rat   283 IKSTEGQSSLT------VTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPT 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 33/93 (35%)
Ig strand B 91..95 CDD:409353 1/3 (33%)
Ig strand C 104..108 CDD:409353 3/3 (100%)
Ig strand E 139..143 CDD:409353 1/3 (33%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 1/2 (50%)
Ig 176..267 CDD:472250 34/97 (35%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 0/3 (0%)
Ig strand E 232..236 CDD:409301 2/3 (67%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 1/2 (50%)
IG_like 282..368 CDD:214653 26/85 (31%)
Ig strand B 288..292 CDD:409353 1/3 (33%)
Ig strand C 301..305 CDD:409353 0/3 (0%)
Ig strand E 330..340 CDD:409353 2/9 (22%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
LsampNP_001401926.1 Ig 55..145 CDD:472250 32/96 (33%)
Ig strand B 66..70 CDD:409382 1/3 (33%)
Ig strand C 78..82 CDD:409382 4/5 (80%)
Ig strand E 111..115 CDD:409382 1/3 (33%)
Ig strand F 125..130 CDD:409382 2/4 (50%)
Ig strand G 138..141 CDD:409382 1/2 (50%)
Ig_3 148..218 CDD:464046 31/84 (37%)
Ig_3 235..311 CDD:464046 25/86 (29%)

Return to query results.
Submit another query.