DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Cntn6

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_037357.1 Gene:Cntn6 / 27256 RGDID:62008 Length:1028 Species:Rattus norvegicus


Alignment Length:325 Identity:79/325 - (24%)
Similarity:133/325 - (40%) Gaps:60/325 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RFAEPIANVTVSVGRDA--LMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHR 137
            ||.|     |:...:|:  .:.|.........::|.|:|...:..   .|...||:.:       
  Rat   232 RFPE-----TIQAAKDSSVKLECFALGNPVPDISWRRLDGSPMPG---KVKYSNSQAT------- 281

  Fly   138 SWYLHIKEVEETDRGWYMCQVNTDPMRSR---KGYLQVVVPPIIVEGLTSNDMVVREGQNISLVC 199
               |.|.:.::.|.|:|.|....  :|.|   ||.|....||...:.:.:..:.:.:  ::...|
  Rat   282 ---LEIPKFQQEDEGFYECVAGN--LRGRNLAKGQLIFYAPPEWEQKIQNTYLSIYD--SLFWEC 339

  Fly   200 KARGYPEPYVMWRREDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKRVH 264
            ||.|.|.|...|.:..  |.|...|.:...:|.|: ||.::......|.|.|.|.. .:|.....
  Rat   340 KASGNPNPSYTWLKNG--ERLNTEERIQTENGTLI-ITMLNVSDSGIYQCAAENKY-QTIYANAE 400

  Fly   265 LRVQFPPMLSIPN-------QLEGAYLGQDVILECHTEAYP-ASINYWTTERGDMIISDTSRAGD 321
            |||    :.|.|:       ::....:|.|:.:||...|:| |||::   :||...:..:.|.  
  Rat   401 LRV----LASAPDFSKNPIKKISVVQVGGDISIECKPNAFPKASISW---KRGTENLKQSKRV-- 456

  Fly   322 KYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSL--GETDGNIKLDEMPTPTTAIISEMSL 384
                     .:.:...|||..|..:|.|:|.|||.|..  |::.|::.:.|. |..|...|:|.:
  Rat   457 ---------FFLEDGSLKICNVTRSDAGSYTCVATNQFGNGKSSGSLIVKER-TVITVPPSKMDV 511

  Fly   385  384
              Rat   512  511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 20/96 (21%)
Ig strand B 91..95 CDD:409353 0/5 (0%)
Ig strand C 104..108 CDD:409353 0/3 (0%)
Ig strand E 139..143 CDD:409353 1/3 (33%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 1/5 (20%)
Ig 176..267 CDD:472250 21/90 (23%)
Ig strand B 195..199 CDD:409301 0/3 (0%)
Ig strand C 208..212 CDD:409301 0/3 (0%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 25/88 (28%)
Ig strand B 288..292 CDD:409353 0/3 (0%)
Ig strand C 301..305 CDD:409353 1/3 (33%)
Ig strand E 330..340 CDD:409353 1/9 (11%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 1/2 (50%)
Cntn6NP_037357.1 Ig 26..120 CDD:472250
Ig strand B 46..50 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 97..102 CDD:409353
Ig strand G 111..114 CDD:409353
Ig 129..214 CDD:472250
Ig strand B 140..144 CDD:409353
Ig strand C 154..158 CDD:409353
Ig strand E 179..183 CDD:409353
Ig strand F 193..198 CDD:409353
Ig strand G 209..212 CDD:409353
Ig 227..315 CDD:472250 23/102 (23%)
Ig strand B 245..249 CDD:409353 0/3 (0%)
Ig strand C 258..262 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 1/13 (8%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Ig strand G 307..310 CDD:409353 0/2 (0%)
Ig 319..403 CDD:472250 20/89 (22%)
Ig strand B 335..339 CDD:143205 0/3 (0%)
Ig strand C 348..352 CDD:143205 0/3 (0%)
Ig strand E 369..373 CDD:143205 2/4 (50%)
Ig strand F 383..388 CDD:143205 2/4 (50%)
Ig strand G 396..399 CDD:143205 0/2 (0%)
Ig5_Contactin 408..496 CDD:409358 26/101 (26%)
Ig strand A 408..413 CDD:409358 1/4 (25%)
Ig strand A' 416..421 CDD:409358 0/4 (0%)
Ig strand B 425..432 CDD:409358 2/6 (33%)
Ig strand C 440..444 CDD:409358 2/6 (33%)
Ig strand D 458..461 CDD:409358 0/2 (0%)
Ig strand E 462..467 CDD:409358 2/4 (50%)
Ig strand F 475..483 CDD:409358 5/7 (71%)
Ig strand G 489..496 CDD:409358 1/6 (17%)
Ig 500..598 CDD:472250 4/12 (33%)
Ig strand B 517..521 CDD:409353
Ig strand C 532..536 CDD:409353
Ig strand E 560..564 CDD:409353
Ig strand F 574..579 CDD:409353
Ig strand G 587..590 CDD:409353
FN3 598..691 CDD:238020
FN3 <620..>912 CDD:442628
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 887..908
FN3 903..983 CDD:214495
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.