DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DIP-kappa and Ermap

DIOPT Version :9

Sequence 1:	NP_723828.1	Gene:	DIP-kappa / 318958	FlyBaseID:	FBgn0051814	Length:	672	Species:	Drosophila melanogaster
Sequence 2:	XP_006503201.1	Gene:	Ermap / 27028	MGIID:	1349816	Length:	626	Species:	Mus musculus

Alignment Length:	122	Identity:	41/122 - (33%)
Similarity:	57/122 - (46%)	Gaps:	20/122 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   128 RISLTYNDHR-SWYLHIKEVEETDRGWYMCQV---NTDPMRSRKGYLQVVV----PPIIVEGLTS 184
            |.:|..:.|: |:.|.|..|...|||.|.|||   |:.  |.....|||.|    |.|.|:|.
Mouse   140 RTALVRDAHKESYILQISNVRLEDRGLYQCQVWVGNSS--REDNVTLQVAVLGSDPYIHVKGY-- 200

  Fly   185 NDMVVREGQNISLVCKARG-YPEPYVMWRREDGEEMLIGGEHVNVVDGELLHITKVS 240
                  :...|.|:|::.| :|:|:..||...|..:|...| |:.:|...|..|.||
Mouse   201 ------DAGWIELLCQSVGWFPKPWTEWRDTTGRALLSLSE-VHSLDENGLFRTAVS 250

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DIP-kappa	NP_723828.1	Ig	80..172	CDD:299845	17/47 (36%)
		IG_like	82..174	CDD:214653	19/49 (39%)
		IG_like	184..267	CDD:214653	17/58 (29%)
		IGc2	191..255	CDD:197706	17/51 (33%)
		IG_like	282..368	CDD:214653
		Ig	288..367	CDD:143165
Ermap	XP_006503201.1	Ig	87..187	CDD:386229	18/48 (38%)
Ermap	XP_006503201.1	SPRY	381..563	CDD:383051
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000