DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Cntn4

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001103219.1 Gene:Cntn4 / 269784 MGIID:1095737 Length:1026 Species:Mus musculus


Alignment Length:612 Identity:127/612 - (20%)
Similarity:204/612 - (33%) Gaps:152/612 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GPHRLPRPHTRRRFRLQAEFNVR---QLAITIIATAAVTM------LMTATPTLAEIPSKGKH-T 59
            ||   |.|...|...:..|:..:   |...|:.|....|:      |....||:....:.||. .
Mouse   207 GP---PTPLILRNDGVMGEYEPKIEVQFPETVPAEKGTTVKLECFALGNPVPTILWRRADGKPIA 268

  Fly    60 RLDTQQTAQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKGYKVA-----------WVRVDTQ 113
            |...:..:....:.|.|.:..|         ....||.||.:|..||           ||::...
Mouse   269 RKARRHKSNGILEIPNFQQEDA---------GSYECVAENSRGKNVAKGQLTFYAQPNWVQIIND 324

  Fly   114 TILSIHHNVI---SQNSRISLTYNDHRSWY------------------LHIKEVEETDRGWYMCQ 157
            ..:::..:|.   ..|.|...||.    |.                  |:|..|..:|.|.|.|.
Mouse   325 IHVAMEESVFWECKANGRPKPTYR----WLKNGDPLLTRDRIQIEQGTLNITIVNLSDAGMYQCV 385

  Fly   158 V-NTDPMRSRKGYLQVVV-PPIIVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWRREDGEEML 220
            . |...:......|.|:. .|.....|.....:|:.|..:.:.||.:..|.|...||:  |.|:|
Mouse   386 AENKHGVIFSSAELSVIAESPDFSRTLLKRVTLVKVGGEVVIECKPKASPRPVYTWRK--GREIL 448

  Fly   221 IGGEHVNVVDGELLHITKVSRLHMAAYLCVASN--GVPPSISKRVHLRVQFPPMLSIPNQLEGAY 283
            ...|.:.:.:...|.|..|::....:|.|:|:|  |...|....:   |:.|..:.:|.......
Mouse   449 RENERITISEDGNLRIINVTKSDAGSYTCIATNHFGTASSTGNVI---VKDPTKVMVPPSSMDVT 510

  Fly   284 LGQDVILECH-TEAYPASINYWTTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPND 347
            :|:.::|.|. |..:...|.:..|..|.:|  |..:.||.:|   .|.|......|.||.:....
Mouse   511 VGESIVLPCQVTHDHSLDIVFTWTFNGHLI--DFDKDGDHFE---RVGGQDSAGDLMIRNIQLKH 570

  Fly   348 FGTYRCVAKNSL---------------GETDGNIKLDEMPTPTTAIISEMSLLNRSYDGKRRH-- 395
            .|.|.|:.:.|:               |..:. :.:||: |.|||.:|..       .|...|  
Mouse   571 AGKYVCMVQTSVDKLSVAADLIVRGPPGPPEA-VTIDEI-TDTTAQLSWR-------PGPDNHSP 626

  Fly   396 --------RNKF----DSANALPD-----------YGVEEWRDGAQGNNAGN---------NGDN 428
                    |..|    .:.|.:||           .|:..|.:......|.|         ..:.
Mouse   627 ITMYVIQARTPFSVGWQAVNTVPDLVDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEK 691

  Fly   429 NQTPVRNPPGAFHNSAGSLAQHNLLAKIMLGIKTQSFGIFKRLSSSLPLAAGQSF---------- 483
            .:|....|.....|.:|.           .|.|::....::.:...|....|..:          
Mouse   692 RRTEEALPEVTPANVSGG-----------GGSKSELVITWETVPEELQNGRGFGYVVAFRPHGKM 745

  Fly   484 LWLSTLSLVSAPSRWRMSNVENRPNSP 510
            :|:.|:...:..||:...|...||.||
Mouse   746 IWMLTVLASADASRYVFRNESVRPFSP 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 25/124 (20%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 2/14 (14%)
Ig strand E 139..143 CDD:409353 2/21 (10%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 0/2 (0%)
Ig 176..267 CDD:472250 23/92 (25%)
Ig strand B 195..199 CDD:409301 0/3 (0%)
Ig strand C 208..212 CDD:409301 0/3 (0%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 22/101 (22%)
Ig strand B 288..292 CDD:409353 1/3 (33%)
Ig strand C 301..305 CDD:409353 1/3 (33%)
Ig strand E 330..340 CDD:409353 2/9 (22%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
Cntn4NP_001103219.1 Ig 25..120 CDD:472250
Ig strand B 46..50 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 97..102 CDD:409353
Ig strand G 111..114 CDD:409353
Ig 129..213 CDD:472250 4/8 (50%)
Ig strand B 140..144 CDD:409353
Ig strand C 154..158 CDD:409353
Ig strand E 177..181 CDD:409353
Ig strand F 191..196 CDD:409353
Ig strand G 207..210 CDD:409353 2/5 (40%)
Ig 225..313 CDD:472250 20/96 (21%)
Ig strand B 243..247 CDD:409353 0/3 (0%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 278..282 CDD:409353 0/3 (0%)
Ig strand F 292..297 CDD:409353 1/4 (25%)
Ig strand G 305..308 CDD:409353 2/2 (100%)
Ig 318..401 CDD:472250 17/86 (20%)
Ig strand B 333..337 CDD:409353 1/3 (33%)
Ig strand C 346..350 CDD:409353 2/7 (29%)
Ig strand E 367..371 CDD:409353 1/3 (33%)
Ig strand F 381..386 CDD:409353 2/4 (50%)
Ig strand G 394..397 CDD:409353 0/2 (0%)
Ig 406..494 CDD:472250 23/92 (25%)
Ig strand B 425..429 CDD:409353 0/3 (0%)
Ig strand C 438..442 CDD:409353 0/3 (0%)
Ig strand E 460..464 CDD:409353 1/3 (33%)
Ig strand F 474..479 CDD:409353 2/4 (50%)
Ig strand G 487..490 CDD:409353 1/2 (50%)
Ig6_Contactin-4 496..597 CDD:409439 23/105 (22%)
Ig strand A 496..502 CDD:409439 1/5 (20%)
Ig strand A' 505..510 CDD:409439 0/4 (0%)
Ig strand B 513..521 CDD:409439 2/7 (29%)
Ig strand C 530..534 CDD:409439 0/3 (0%)
Ig strand D 555..558 CDD:409439 0/2 (0%)
Ig strand E 559..563 CDD:409439 1/3 (33%)
Ig strand F 572..579 CDD:409439 3/6 (50%)
FN3 580..>1014 CDD:442628 37/213 (17%)
Ig strand G 586..590 CDD:409439 0/3 (0%)
FN3 597..690 CDD:238020 19/101 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..710 4/35 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 886..906
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.