DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and DIP-lambda

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster


Alignment Length:393 Identity:152/393 - (38%)
Similarity:225/393 - (57%) Gaps:31/393 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TRRRFRLQAEFNVRQLAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAE 78
            |::..|::........:|..|...|:|  :|....:|.|..||:...:|           |:|..
  Fly     3 TKKTARIKMYNGTLACSIAFILIKAIT--ITKCHAVAHIHGKGESEEID-----------PQFLA 54

  Fly    79 PIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHI 143
            .::|.||.:|||....|||:||..|:|||::.|::.||.||.:::|.|.|:|:|:|.|.:|.|||
  Fly    55 KLSNTTVPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHI 119

  Fly   144 KEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSN--DMVVREGQNISLVCKARGYPE 206
            ..|:..|.|.||||||||||:|..|||.|||||.|:.....|  |.|.:||.:|||:|...|.|.
  Fly   120 SRVQINDSGSYMCQVNTDPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPR 184

  Fly   207 PYVMWRREDGEEMLI---GGEHVNV--VDGELLHITKVSRLHMAAYLCVASNGVPPSISKRVHLR 266
            |.|:||||.|:|:::   |.:....  |:||.|.:|.|.|..|..|.|:||||:|||:|||.::.
  Fly   185 PKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVY 249

  Fly   267 VQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYETTSTVSG 331
            |.|.|.:...:||.||.:.::|.|||..|.:|..:|.|....|::.:.:    |:||..:..|..
  Fly   250 VNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGWYRSEGNIKLHN----GNKYNISEEVIN 310

  Fly   332 -YTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDEMPTP---TTAIISEMSLLNRSYDGK 392
             ||.::.|.||.:..:|||||.|.:.|:||:::..|:|.|:..|   ||.....|....:|   :
  Fly   311 IYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTPTPHMQTTGKS---R 372

  Fly   393 RRH 395
            |:|
  Fly   373 RKH 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 49/91 (54%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 2/3 (67%)
Ig strand E 139..143 CDD:409353 2/3 (67%)
Ig strand F 153..158 CDD:409353 3/4 (75%)
Ig strand G 165..168 CDD:409353 1/2 (50%)
Ig 176..267 CDD:472250 42/97 (43%)
Ig strand B 195..199 CDD:409301 3/3 (100%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 2/3 (67%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 2/2 (100%)
IG_like 282..368 CDD:214653 29/86 (34%)
Ig strand B 288..292 CDD:409353 2/3 (67%)
Ig strand C 301..305 CDD:409353 1/3 (33%)
Ig strand E 330..340 CDD:409353 3/10 (30%)
Ig strand F 350..355 CDD:409353 3/4 (75%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653 49/92 (53%)
Ig strand B 67..71 CDD:409353 0/3 (0%)
Ig strand E 115..119 CDD:409353 2/3 (67%)
Ig strand F 129..134 CDD:409353 3/4 (75%)
Ig 153..250 CDD:472250 41/96 (43%)
Ig strand B 173..177 CDD:409353 3/3 (100%)
Ig strand C 186..190 CDD:409353 1/3 (33%)
Ig strand E 204..219 CDD:409353 4/14 (29%)
Ig strand F 229..234 CDD:409353 2/4 (50%)
Ig strand G 243..246 CDD:409353 2/2 (100%)
IG_like 271..349 CDD:214653 28/81 (35%)
Ig strand B 271..275 CDD:409353 2/3 (67%)
Ig strand C 284..288 CDD:409353 1/3 (33%)
Ig strand E 308..320 CDD:409353 4/11 (36%)
Ig strand F 330..335 CDD:409353 3/4 (75%)

Return to query results.
Submit another query.