DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and NEGR1

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:327 Identity:91/327 - (27%)
Similarity:149/327 - (45%) Gaps:58/327 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 AQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISL 131
            |.:..|||..|  :.|:.|..|..|::.|.:|: ...|.||  ::..:|:....:..|.:.|:|:
Human    34 AGQSVDFPWAA--VDNMMVRKGDTAVLRCYLED-GASKGAW--LNRSSIIFAGGDKWSVDPRVSI 93

  Fly   132 TYNDHRSWYLHIKEVEETDRGWYMCQVNTD-PMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNI 195
            :..:.|.:.|.|:.|:.||.|.|.|.|.|. ..|:.:.:|.|.|||.|.:  .||||.|.||.|:
Human    94 STLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYD--ISNDMTVNEGTNV 156

  Fly   196 SLVCKARGYPEPYVMWRREDGEEMLIGGEHVN-----VVDGELLHITKVSRLHMAAYLCVASNGV 255
            :|.|.|.|.|||.:.||            |::     ..:|:.|.|..::|.....|.|.|.|.|
Human   157 TLTCLATGKPEPSISWR------------HISPSAKPFENGQYLDIYGITRDQAGEYECSAENDV 209

  Fly   256 PPSISKRVHLRVQFPPMLSIPNQLEGAYL--GQDVILECHTEAYPASINYW--------TTERGD 310
            .....::|.:.|.|.|.:   .:::...:  |:..::.|.....|.....|        ..::|.
Human   210 SFPDVRKVKVVVNFAPTI---QEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGI 271

  Fly   311 MIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDEMPTPT 375
            :|.:.::|      :..||:..|:           ..||.|.|||.|.||.|:.::.|:   .|:
Human   272 IIQNFSTR------SILTVTNVTQ-----------EHFGNYTCVAANKLGTTNASLPLN---PPS 316

  Fly   376 TA 377
            ||
Human   317 TA 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 26/92 (28%)
IG_like 82..174 CDD:214653 27/92 (29%)
IG_like 184..267 CDD:214653 28/87 (32%)
IGc2 191..255 CDD:197706 21/68 (31%)
IG_like 282..368 CDD:214653 20/95 (21%)
Ig 288..367 CDD:143165 19/86 (22%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 26/90 (29%)
IGc2 152..210 CDD:197706 21/69 (30%)
Ig_3 225..301 CDD:372822 17/95 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143460
Domainoid 1 1.000 45 1.000 Domainoid score I12195
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.