DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Lrit1

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_647547.2 Gene:Lrit1 / 246214 RGDID:628607 Length:623 Species:Rattus norvegicus


Alignment Length:438 Identity:93/438 - (21%)
Similarity:141/438 - (32%) Gaps:130/438 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLPRPHTRR----RFRLQAEFNVRQLAITIIATAAV-TMLMTATPTLAEIPSKGKH-------TR 60
            ||.|...||    .||..:  .:.||.:...|.:.: |:::.....|.|:...|.|       ..
  Rat    65 RLERTAIRRVPGETFRPLS--RLEQLWLPYNALSELSTLMLRGLRRLRELRLPGNHLVTFPWAAL 127

  Fly    61 LDTQQTAQEDSDF-------PRFAEPIANVT-VSVGRDALMACVVENLKGYKVAWVRVDTQTILS 117
            .||.|....|...       |.....:.|:| :.:..:.||....|.|.    .|..:.|...||
  Rat   128 KDTPQLQLLDLQANRLSTLPPEAVHFLENLTFLDLSNNQLMRLPEELLD----TWAHLKTGPYLS 188

  Fly   118 IHHNVISQNSRISLTYNDHRSW--------YLHIKEVEETDRGW------YMCQVNTDPMRSRKG 168
                  |:.:|:.|...|: .|        .:|:.:      ||      ...::.....||..|
  Rat   189 ------SRRTRLVLGLQDN-PWVCDCRLYDLVHLLD------GWASNLIFIEARLRCGSPRSLAG 240

  Fly   169 Y------LQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWRREDGEEMLIGGEHVN 227
            .      |:....|.:..|:||  ::...|..:.|.|.|.|.|.|.:.|||.:|.. |.|..|..
  Rat   241 VAFSQLELRKCQSPELRPGVTS--IISPLGSTVLLRCGATGIPGPEMSWRRANGRP-LNGTVHQE 302

  Fly   228 V-VDGE---LLHITKVSRLHMAAYLCVASN-----------------------GVP--------- 256
            | .||.   ||.:..||......|:|.|.|                       |:|         
  Rat   303 VSSDGSSWTLLDLPVVSLFDSGDYICQAKNFLGASETLISLIVTEPQTSTEYTGIPGALWARTGE 367

  Fly   257 ----------------PSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINYWT 305
                            |.:.:.|.|..: |.:.||..:|.......||         |...:...
  Rat   368 GAEAAAYNNKLVARHVPHVPEPVALATK-PSVPSIKEELPLQNFQMDV---------PGEFSREP 422

  Fly   306 TERGD-MIISDTSRAGDKYETTSTV-----SGYTKYMKLKIRAVGPND 347
            :|..: .::......||.|.:.|.|     :|.|....:.....|..|
  Rat   423 SEHQETQMVRSLKVVGDTYHSVSLVWKAPQAGNTTAFSVLYAVFGQRD 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 22/112 (20%)
IG_like 82..174 CDD:214653 22/112 (20%)
IG_like 184..267 CDD:214653 31/134 (23%)
IGc2 191..255 CDD:197706 25/90 (28%)
IG_like 282..368 CDD:214653 13/72 (18%)
Ig 288..367 CDD:143165 12/66 (18%)
Lrit1NP_647547.2 LRRNT 23..61 CDD:214470
LRR 1 60..81 6/15 (40%)
LRR_8 63..143 CDD:290566 19/79 (24%)
leucine-rich repeat 64..84 CDD:275378 7/20 (35%)
LRR 2 84..105 4/20 (20%)
leucine-rich repeat 85..132 CDD:275378 10/46 (22%)
LRR 3 108..128 4/19 (21%)
LRR_8 131..>176 CDD:290566 8/44 (18%)
LRR_4 131..172 CDD:289563 7/40 (18%)
LRR 4 132..153 3/20 (15%)
leucine-rich repeat 133..156 CDD:275378 2/22 (9%)
LRR 5 156..177 6/24 (25%)
leucine-rich repeat 157..180 CDD:275378 6/26 (23%)
leucine-rich repeat 181..205 CDD:275378 8/30 (27%)
TPKR_C2 201..>240 CDD:301599 6/45 (13%)
Ig 257..345 CDD:299845 28/90 (31%)
IG_like 267..345 CDD:214653 25/78 (32%)
FN3 431..501 CDD:214495 9/40 (23%)
LRR 6 525..548
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.