DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Lrit3

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001274153.1 Gene:Lrit3 / 242235 MGIID:2685267 Length:681 Species:Mus musculus


Alignment Length:163 Identity:37/163 - (22%)
Similarity:60/163 - (36%) Gaps:26/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 HITKVSRL-----HMAAYL-----CVASNGVPPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVI 289
            ||:||..|     |....|     |.........:.:||.|.....|.:.:......:.||.:|:
Mouse   208 HISKVIELSKVTDHAVVLLDPLMVCSEPERFQGILFQRVELEKCLKPSVMMSATKITSALGSNVL 272

  Fly   290 LECHTEAYPASINYWTTERGD----MIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGT 350
            |.|..:.:|.....||...|.    .:|.::...|.::...|..|            :...|.|.
Mouse   273 LRCDAKGHPTPQLTWTRSDGSTVNYTVIQESPGEGIRWSIISLTS------------ISHKDAGD 325

  Fly   351 YRCVAKNSLGETDGNIKLDEMPTPTTAIISEMS 383
            |||.|||..|.::..:.:..:...||.:..:.|
Mouse   326 YRCKAKNLAGISEAVVTVTVVGGVTTTLSPDSS 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845
IG_like 82..174 CDD:214653
IG_like 184..267 CDD:214653 11/41 (27%)
IGc2 191..255 CDD:197706 8/29 (28%)
IG_like 282..368 CDD:214653 22/89 (25%)
Ig 288..367 CDD:143165 20/82 (24%)
Lrit3NP_001274153.1 LRR 1. /evidence=ECO:0000255 56..79
LRR_8 61..117 CDD:290566
LRR 2. /evidence=ECO:0000255 80..103
leucine-rich repeat 83..106 CDD:275378
LRR 3. /evidence=ECO:0000255 104..128
LRR_8 105..165 CDD:290566
LRR_4 106..146 CDD:289563
leucine-rich repeat 107..130 CDD:275378
LRR_4 129..170 CDD:289563
LRR 4. /evidence=ECO:0000255 129..151
leucine-rich repeat 131..154 CDD:275378
LRR 5. /evidence=ECO:0000255 152..175
leucine-rich repeat 155..168 CDD:275378
Ig 254..335 CDD:299845 22/92 (24%)
IG_like 263..339 CDD:214653 22/87 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..391 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..464
FN3 489..563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.