DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Vtcn1

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_848709.2 Gene:Vtcn1 / 242122 MGIID:3039619 Length:283 Species:Mus musculus


Alignment Length:341 Identity:59/341 - (17%)
Similarity:104/341 - (30%) Gaps:148/341 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SVGRDALMACVVE---NLKGYKVAWVRVDTQTI----------LSIHHNVISQNSRISLTYNDHR 137
            ::|.|..::|..|   .|.|..:.|::...:.:          ||..|.:....:.:........
Mouse    47 NIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVG 111

  Fly   138 SWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQV-------VVPPIIVEGLTSNDMVVREGQNI 195
            :..|.:|.|:.||.|.|.|.:.|.   ..||...:       .:|.|.|:...|::         
Mouse   112 NASLRLKNVQLTDAGTYTCYIRTS---KGKGNANLEYK
TGAFSMPEINVDYNASSE--------- 164

  Fly   196 SLVCKA-RGYPEPYVMWRREDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSI 259
            ||.|:| |.:|:|.|.|                           .|::...|.....||......
Mouse   165 SLRCEAPRWFPQPTVAW---------------------------ASQVDQGANFSEVSNTSFELN 202

  Fly   260 SKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYE 324
            |:.|.::|     :|:                    .|..:||                      
Mouse   203 SENVTMKV-----VSV--------------------LYNVTIN---------------------- 220

  Fly   325 TTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIK--------------LDEMPTP- 374
                                    .||.|:.:|.:.:..|:||              |:..|:| 
Mouse   221 ------------------------NTYSCMIENDIAKATGDIKVTDSEVKRRSQLQLLNSGPSPC 261

  Fly   375 --TTAIISEMSLLNRS 388
              ::|.::..:||:.|
Mouse   262 VFSSAFVAGWALLSLS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 21/98 (21%)
IG_like 82..174 CDD:214653 21/107 (20%)
IG_like 184..267 CDD:214653 16/83 (19%)
IGc2 191..255 CDD:197706 13/64 (20%)
IG_like 282..368 CDD:214653 10/99 (10%)
Ig 288..367 CDD:143165 8/78 (10%)
Vtcn1NP_848709.2 IG_like 46..144 CDD:214653 21/99 (21%)
Ig 49..146 CDD:299845 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.