DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Btn2a2

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001276544.1 Gene:Btn2a2 / 238555 MGIID:3606486 Length:514 Species:Mus musculus


Alignment Length:201 Identity:45/201 - (22%)
Similarity:77/201 - (38%) Gaps:58/201 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSD-----------FPRFAEPIAN 82
            |::.::.:|..|::..|.|.||.:   |::|.|....:.:.:::           ||.       
Mouse    21 LSLFVLVSAQFTVIGPAEPILAMV---GENTTLHCHLSPERNAEEMEVRWFRWRFFPA------- 75

  Fly    83 VTVSVGRDALMACVVENLKGY--KVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIKE 145
            |.|..|......   |.:..|  :..::|.|           ||: .|::|.          |..
Mouse    76 VLVYRGHQERPE---EQMVAYRGRTTFMRTD-----------ISK-GRVALI----------IHN 115

  Fly   146 VEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMV---VREGQNISLVCKARG-YPE 206
            |...|.|.|.|.     .:..:.|.|..: .::|..|.|..::   ..|..:|.|.|.:.| |||
Mouse   116 VTAYDNGIYCCY-----FQEGRSYDQATM-KLMVASLGSEPLIKMKTLEDGSILLECTSEGWYPE 174

  Fly   207 PYVMWR 212
            |..:||
Mouse   175 PRAVWR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 18/93 (19%)
IG_like 82..174 CDD:214653 19/93 (20%)
IG_like 184..267 CDD:214653 12/33 (36%)
IGc2 191..255 CDD:197706 11/23 (48%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
Btn2a2NP_001276544.1 Ig_MOG_like 45..144 CDD:319291 24/136 (18%)
Ig <165..236 CDD:386229 8/16 (50%)
SPRY_PRY_BTN1_2 312..482 CDD:293991
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.