Sequence 1: | NP_723828.1 | Gene: | DIP-kappa / 318958 | FlyBaseID: | FBgn0051814 | Length: | 672 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001276544.1 | Gene: | Btn2a2 / 238555 | MGIID: | 3606486 | Length: | 514 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 45/201 - (22%) |
---|---|---|---|
Similarity: | 77/201 - (38%) | Gaps: | 58/201 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 LAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSD-----------FPRFAEPIAN 82
Fly 83 VTVSVGRDALMACVVENLKGY--KVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIKE 145
Fly 146 VEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMV---VREGQNISLVCKARG-YPE 206
Fly 207 PYVMWR 212 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-kappa | NP_723828.1 | Ig | 80..172 | CDD:299845 | 18/93 (19%) |
IG_like | 82..174 | CDD:214653 | 19/93 (20%) | ||
IG_like | 184..267 | CDD:214653 | 12/33 (36%) | ||
IGc2 | 191..255 | CDD:197706 | 11/23 (48%) | ||
IG_like | 282..368 | CDD:214653 | |||
Ig | 288..367 | CDD:143165 | |||
Btn2a2 | NP_001276544.1 | Ig_MOG_like | 45..144 | CDD:319291 | 24/136 (18%) |
Ig | <165..236 | CDD:386229 | 8/16 (50%) | ||
SPRY_PRY_BTN1_2 | 312..482 | CDD:293991 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |