DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and IGSF9B

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:363 Identity:95/363 - (26%)
Similarity:144/363 - (39%) Gaps:83/363 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEPIANVTVSVGRDALMAC 95
            |..:||...:::.|     ..:.::|.|       ..:|:.:|         ||...|...::.|
Human     2 IWYVATFIASVIGT-----RGLAAEGAH-------GLREEPEF---------VTARAGESVVLRC 45

  Fly    96 -VVENLKG----YKVAWVRVDTQTILSIH------HNVISQNSRISLTYNDHRSWYLHIKEVEET 149
             |:..:.|    |.|.|.:......:.|.      |.......|.||    |....|.:::|...
Human    46 DVIHPVTGQPPPYVVEWFKFGVPIPIFIKFGYYPPHVDPEYAGRASL----HDKASLRLEQVRSE 106

  Fly   150 DRGWYMCQV-----NTDPMRSRKG-YLQVVVPPIIVEGLTSNDMV-VREGQNISLVCKARGYPEP 207
            |:|||.|:|     ..|...:... :|.:..||...|  |....: .:||.:|::.|.|.|.|:|
Human   107 DQGWYECKVLMLDQQYDTFHNGSWVHLTINAPPTFTE--TPPQYIEAKEGGSITMTCTAFGNPKP 169

  Fly   208 YVMWRREDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKRVHLRVQFPPM 272
            .|.|.:| |..:...|:: .|.||.|. :|.|||....||.|.|.: :........||.||.||.
Human   170 IVTWLKE-GTLLGASGKY-QVSDGSLT-VTSVSREDRGAYTCRAYS-IQGEAVHTTHLLVQGPPF 230

  Fly   273 LSIPNQLEGAYLGQDVILECHTEAYPASIN---YWTTERGDMIISDTSRAGDKYETTSTVSGYTK 334
            :..|.:.....:.||.:|.|..||||.::.   ||..|             :.|        :..
Human   231 IVSPPENITVNISQDALLTCRAEAYPGNLTYTWYWQDE-------------NVY--------FQN 274

  Fly   335 YMKLKIR----------AVGPNDFGTYRCVAKNSLGET 362
            .:||::|          .|.|.|.|.|.||..||||.:
Human   275 DLKLRVRILIDGTLIIFRVKPEDSGKYTCVPSNSLGRS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 25/108 (23%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 1/3 (33%)
Ig strand E 139..143 CDD:409353 1/3 (33%)
Ig strand F 153..158 CDD:409353 3/4 (75%)
Ig strand G 165..168 CDD:409353 0/2 (0%)
Ig 176..267 CDD:472250 30/91 (33%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 3/4 (75%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 26/94 (28%)
Ig strand B 288..292 CDD:409353 1/3 (33%)
Ig strand C 301..305 CDD:409353 1/6 (17%)
Ig strand E 330..340 CDD:409353 2/9 (22%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 95/363 (26%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653 23/97 (24%)
Ig strand B 41..45 CDD:409353 0/3 (0%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
Ig strand E 96..100 CDD:409353 1/3 (33%)
Ig strand F 110..115 CDD:409353 3/4 (75%)
I-set 139..225 CDD:400151 30/91 (33%)
Ig strand B 157..161 CDD:409353 1/3 (33%)
Ig strand C 170..174 CDD:409353 1/3 (33%)
Ig strand E 191..195 CDD:409353 2/4 (50%)
Ig strand F 205..210 CDD:409353 3/4 (75%)
Ig strand G 218..221 CDD:409353 0/2 (0%)
Ig_3 228..307 CDD:464046 25/99 (25%)
Ig 336..410 CDD:472250
Ig strand B 342..346 CDD:409353
Ig strand C 355..360 CDD:409353
Ig strand E 380..384 CDD:409353
Ig strand F 394..399 CDD:409353
Ig strand G 407..410 CDD:409353
Ig 429..505 CDD:472250
Ig strand B 438..442 CDD:409353
Ig strand C 451..455 CDD:409353
Ig strand E 471..475 CDD:409353
Ig strand F 485..490 CDD:409353
FN3 <490..>731 CDD:442628
Ig strand G 498..501 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
PHA03247 <894..1242 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.