DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Iglon5

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:392 Identity:112/392 - (28%)
Similarity:165/392 - (42%) Gaps:75/392 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LPRPHTRRRFRLQAEFNVRQLAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDF 73
            :|.|....|.||        ||...:|..||.             |:|    |.:|..       
Mouse     1 MPPPAPGARLRL--------LAAAALAGLAVI-------------SRG----LLSQSL------- 33

  Fly    74 PRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRS 138
             .|:.|..|.||..|.:|.::|.::. ...:|||  ::...||...::..:.:.|:.|..|....
Mouse    34 -EFSSPADNYTVCEGDNATLSCFIDE-HVTRVAW--LNRSNILYAGNDRWTSDPRVRLLINTPEE 94

  Fly   139 WYLHIKEVEETDRGWYMCQVNT--DPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKA 201
            :.:.|.:|...|.|.|.|...|  .|..::. ||.|.||..||.  .|:.:.|.||.|::|:|.|
Mouse    95 FSILITQVGLGDEGLYTCSFQTRHQPYTTQV-YLIVHVPARIVN--ISSPVAVNEGGNVNLLCLA 156

  Fly   202 RGYPEPYVMWRR-EDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGV--PPSISKRV 263
            .|.|||.|.||: .||          ...:||:|.|:.:.|.....|.||..|||  .|. |:||
Mouse   157 VGRPEPTVTWRQLRDG----------FTSEGEILEISDIQRGQAGEYECVTHNGVNSAPD-SRRV 210

  Fly   264 HLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYETTST 328
            .:.|.:||.::.......| ||:..:|.|...|.|.:...|  .:.|.::|..|..|.|.:|..|
Mouse   211 LVTVNYPPTITDVTSARTA-LGRAALLRCEAMAVPPADFQW--YKDDRLLSSGSAEGLKVQTERT 272

  Fly   329 VSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKL----------DEMPTPTTAIISEMS 383
            .|      .|....|....:|.|.|.|.|.||.:..:::|          ...|.|.| ::|.:|
Mouse   273 RS------MLLFANVSARHYGNYTCRAANRLGASSASMRLLRPGSLENSAPRPPGPLT-LLSALS 330

  Fly   384 LL 385
            .|
Mouse   331 WL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 24/93 (26%)
IG_like 82..174 CDD:214653 25/93 (27%)
IG_like 184..267 CDD:214653 32/85 (38%)
IGc2 191..255 CDD:197706 24/64 (38%)
IG_like 282..368 CDD:214653 25/85 (29%)
Ig 288..367 CDD:143165 22/78 (28%)
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 24/91 (26%)
Ig strand A' 41..46 CDD:409353 3/4 (75%)
Ig strand B 48..56 CDD:409353 2/7 (29%)
CDR1 56..60 CDD:409353 0/4 (0%)
FR2 61..68 CDD:409353 3/8 (38%)
Ig strand C 61..67 CDD:409353 3/7 (43%)
CDR2 69..79 CDD:409353 2/9 (22%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 9/34 (26%)
Ig strand D 84..91 CDD:409353 2/6 (33%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 3/9 (33%)
FR4 122..129 CDD:409353 2/7 (29%)
Ig strand A 132..137 CDD:409353 2/4 (50%)
Ig_3 134..199 CDD:404760 27/76 (36%)
Ig strand A' 140..145 CDD:409353 0/4 (0%)
Ig strand B 148..157 CDD:409353 3/8 (38%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand D 174..177 CDD:409353 0/2 (0%)
Ig strand E 178..183 CDD:409353 2/4 (50%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig_3 217..295 CDD:404760 24/86 (28%)
putative Ig strand A 218..224 CDD:409353 1/5 (20%)
Ig strand B 234..238 CDD:409353 1/3 (33%)
Ig strand C 247..251 CDD:409353 1/5 (20%)
Ig strand E 274..278 CDD:409353 2/9 (22%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833621
Domainoid 1 1.000 45 1.000 Domainoid score I12107
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.