DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and zig-2

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:217 Identity:55/217 - (25%)
Similarity:82/217 - (37%) Gaps:51/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 PIIVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWRREDGEEMLIGGEHV-NVVDGELLHITKV 239
            |::....|.||..|..|:...|.|.|.|.|.|.:.|....   |.|.||.. ||.:..|....:|
 Worm    31 PLLKFTRTPNDSNVTFGEKFVLSCGANGAPLPSIYWELNG---MRIQGEETSNVYENILNDGKQV 92

  Fly   240 SRLHM---------------AAYLCVASNGVPPSISKRVHLRVQF--------------PPMLSI 275
            |...|               .||.|:..||    ::|..|:...|              .|.:|:
 Worm    93 SNAAMVSSHYRIPCATARNSGAYKCIIDNG----LTKLEHVAKVFVGGNKTNCALNDNGAPFISM 153

  Fly   276 PNQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKI 340
            ............|.|.|.:|    :...|:..:|:.::::.   |::|:...  ||     .|.|
 Worm   154 TVDFRLEISNNAVALSCRSE----TATEWSWHKGEQLLTND---GERYQMFP--SG-----DLII 204

  Fly   341 RAVGPNDFGTYRCVAKNSLGET 362
            |.:..:|.|.|.|.|:|..|||
 Worm   205 RNISWSDMGEYNCTARNHFGET 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845
IG_like 82..174 CDD:214653
IG_like 184..267 CDD:214653 28/98 (29%)
IGc2 191..255 CDD:197706 22/79 (28%)
IG_like 282..368 CDD:214653 22/81 (27%)
Ig 288..367 CDD:143165 22/75 (29%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 29/106 (27%)
Ig 34..121 CDD:299845 25/89 (28%)
Ig <179..232 CDD:299845 17/58 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.