Sequence 1: | NP_723828.1 | Gene: | DIP-kappa / 318958 | FlyBaseID: | FBgn0051814 | Length: | 672 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510069.1 | Gene: | zig-2 / 192087 | WormBaseID: | WBGene00006979 | Length: | 238 | Species: | Caenorhabditis elegans |
Alignment Length: | 217 | Identity: | 55/217 - (25%) |
---|---|---|---|
Similarity: | 82/217 - (37%) | Gaps: | 51/217 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 176 PIIVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWRREDGEEMLIGGEHV-NVVDGELLHITKV 239
Fly 240 SRLHM---------------AAYLCVASNGVPPSISKRVHLRVQF--------------PPMLSI 275
Fly 276 PNQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKI 340
Fly 341 RAVGPNDFGTYRCVAKNSLGET 362 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-kappa | NP_723828.1 | Ig | 80..172 | CDD:299845 | |
IG_like | 82..174 | CDD:214653 | |||
IG_like | 184..267 | CDD:214653 | 28/98 (29%) | ||
IGc2 | 191..255 | CDD:197706 | 22/79 (28%) | ||
IG_like | 282..368 | CDD:214653 | 22/81 (27%) | ||
Ig | 288..367 | CDD:143165 | 22/75 (29%) | ||
zig-2 | NP_510069.1 | I-set | 34..134 | CDD:254352 | 29/106 (27%) |
Ig | 34..121 | CDD:299845 | 25/89 (28%) | ||
Ig | <179..232 | CDD:299845 | 17/58 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |