DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and zig-4

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:234 Identity:47/234 - (20%)
Similarity:83/234 - (35%) Gaps:59/234 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 QVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWRREDGEEMLI 221
            :::|:.:.| ...:::|.|        ....::..|:...|.|.....|...:.|:...  :::.
 Worm    34 EIDTNYLTS-PAKIKIVAP--------LESALIPGGETYQLRCDIMSTPAATIHWKFNG--KLIQ 87

  Fly   222 GGEHVNV-----------VD----GELLHITKVSRLHMAAYLCVASNGVPPSISKRVHLRVQFPP 271
            |...:||           ||    ..:|.|...|..:...|.||..||         |..::...
 Worm    88 GSNELNVEEKLLNFGKAIVDTGIVASILTIQCPSAENSGTYSCVGYNG---------HQTIETVA 143

  Fly   272 MLSIPNQLEGAYLGQDVILECHTEAYPA-SINYWTTERGDM---IISDTSRAGDKYE-----TTS 327
            .:.|..:..|          |.:....| .|.:||..|.:|   :.:...||..:.:     ...
 Worm   144 EVEIEGEASG----------CRSNHKSAPEIVFWTDSRFEMTGNVATLVCRANQQVDWVWMSNDE 198

  Fly   328 TVSGYTKYMKLK-----IRAVGPNDFGTYRCVAKNSLGE 361
            .|....|:..|.     |:.:..:|.|||.|:|:|..||
 Worm   199 LVKNNDKFTVLSNGDLVIKNIVWDDMGTYTCIARNQFGE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 2/14 (14%)
IG_like 82..174 CDD:214653 2/16 (13%)
IG_like 184..267 CDD:214653 19/97 (20%)
IGc2 191..255 CDD:197706 17/78 (22%)
IG_like 282..368 CDD:214653 22/94 (23%)
Ig 288..367 CDD:143165 22/88 (25%)
zig-4NP_509335.1 I-set 47..147 CDD:254352 21/118 (18%)
Ig 65..144 CDD:143165 18/89 (20%)
IG_like 176..245 CDD:214653 15/62 (24%)
Ig <193..238 CDD:299845 13/45 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.