DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and IGSF5

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_011527774.1 Gene:IGSF5 / 150084 HGNCID:5952 Length:497 Species:Homo sapiens


Alignment Length:475 Identity:93/475 - (19%)
Similarity:145/475 - (30%) Gaps:197/475 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIH-HNVISQNSRISLTYNDHRSWYLHIKE 145
            ::|.:..||.:..|.|                 :.|:| |..:.| :|.:      |.::||   
Human    62 SLTSNFSRDGVCFCSV-----------------VKSLHAHRGLLQ-ARAA------RFYFLH--- 99

  Fly   146 VEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVE---GLTSNDMVVREGQNISLV--------C 199
                          .|...:..|....::..|.:|   |..|.:.|:...||..::        |
Human   100 --------------QDSSHATNGESSQLLELIFLEKNAGSGSGNEVIEGPQNARVLKGSQARFNC 150

  Fly   200 K-ARGYPEPYVMW-------------------------RREDG----EEMLIGGEHVNVVD-GEL 233
            . ::|:  ..:||                         |.:.|    .||:|  .:|...| |.:
Human   151 TVSQGW--KLIMWALSDMVVLSVRPMEPIITNDRFTSQRYDQGGNFTSEMII--HNVEPSDSGNI 211

  Fly   234 LHITKVSRLHMAAYLCVASNGVPPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILE---CHTE 295
            ....:.||||.:|||.|...|            ..|.|.:::            |:.|   |...
Human   212 RCSLQNSRLHGSAYLTVQVMG------------ELFIPSVNL------------VVAENEPCEVT 252

  Fly   296 AYPASINYWTT------ERGDMIISDTSR--AGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYR 352
            ..|   ::||.      |.| :::|.:|.  ..:..:..|.||         |.|:.|...||..
Human   253 CLP---SHWTRLPDISWELG-LLVSHSSYYFVPEPSDLQSAVS---------ILALTPQSNGTLT 304

  Fly   353 CVAK-NSL----------------GETDGNIK----LDEMP----------------------TP 374
            |||. .||                .:|.|.|.    |..:|                      ||
Human   305 CVATWKSLKARKSATVNLTVIRCPQDTGGGINIPGVLSSLPSLGFSLPTWGKVGLGLAGTMLLTP 369

  Fly   375 TTAIISEMSLLNRSYDG-------------KRRHRNKFDSANALPDYGVEEWRDGAQGN-NAGNN 425
            |..:........|...|             ||..|.:|...:.......|  .:...|| |:|.|
Human   370 TCTLTIRCCCCRRRCCGCNCCCRCCFCCRRKRGFRIQFQKKSEKEKTNKE--TETESGNENSGYN 432

  Fly   426 GDNNQT--PVRNPPGAFHNS 443
            .|..:|  ....||.:..:|
Human   433 SDEQKTTDTASLPPKSCESS 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 15/90 (17%)
IG_like 82..174 CDD:214653 15/92 (16%)
IG_like 184..267 CDD:214653 25/121 (21%)
IGc2 191..255 CDD:197706 22/102 (22%)
IG_like 282..368 CDD:214653 26/117 (22%)
Ig 288..367 CDD:143165 25/106 (24%)
IGSF5XP_011527774.1 IG_like 135..228 CDD:214653 21/96 (22%)
Ig <200..230 CDD:299845 12/31 (39%)
Ig 236..307 CDD:299845 20/95 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.