DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Opcml

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:322 Identity:102/322 - (31%)
Similarity:153/322 - (47%) Gaps:49/322 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DSDFPRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYN 134
            |:.||:..:   ||||..|..|.:.|.::: :..:|||  ::..|||...::..|.:.|:.:..|
  Rat    35 DATFPKAMD---NVTVRQGESATLRCTIDD-RVTRVAW--LNRSTILYAGNDKWSIDPRVIILVN 93

  Fly   135 DHRSWYLHIKEVEETDRGWYMCQVNTD--PMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISL 197
            ....:.:.|:.|:..|.|.|.|.|.||  |..||. :|.|.|||.|:.  .|:|:.|.||.:::|
  Rat    94 TPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRV-HLIVQVPPQIMN--ISSDITVNEGSSVTL 155

  Fly   198 VCKARGYPEPYVMWRREDGEEMLIGGEHVNVVDG-------ELLHITKVSRLHMAAYLCVASNGV 255
            :|.|.|.|||.|.||            |::|.:|       |.|.|:.:.|.....|.|.|.|.|
  Rat   156 LCLAIGRPEPTVTWR------------HLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDV 208

  Fly   256 PPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRA- 319
            .....::|.:.|.:||.:|.... .|..:||..||.|...|.|.:...|..|       ||..| 
  Rat   209 AAPDVRKVKITVNYPPYISKAKN-TGVSVGQKGILSCEASAVPMAEFQWFKE-------DTRLAT 265

  Fly   320 ---GDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDEMPTPTTAI 378
               |.:.|....:|..|.:      .|...|:|.|.|||.|.||.|:.:|.|.|: :|::|:
  Rat   266 GLDGVRIENKGRISTLTFF------NVSEKDYGNYTCVATNKLGNTNASITLYEI-SPSSAV 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 30/93 (32%)
Ig strand B 91..95 CDD:409353 1/3 (33%)
Ig strand C 104..108 CDD:409353 2/3 (67%)
Ig strand E 139..143 CDD:409353 0/3 (0%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 2/2 (100%)
Ig 176..267 CDD:472250 30/97 (31%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 2/3 (67%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 28/89 (31%)
Ig strand B 288..292 CDD:409353 2/3 (67%)
Ig strand C 301..305 CDD:409353 0/3 (0%)
Ig strand E 330..340 CDD:409353 2/9 (22%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
OpcmlXP_017450901.1 Ig 44..132 CDD:472250 29/91 (32%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 65..69 CDD:409353 3/5 (60%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
Ig_3 135..206 CDD:464046 28/84 (33%)
Ig 224..312 CDD:472250 31/101 (31%)
Ig strand B 240..244 CDD:409353 2/3 (67%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.