DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and BTN3A1

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_008979.3 Gene:BTN3A1 / 11119 HGNCID:1138 Length:513 Species:Homo sapiens


Alignment Length:160 Identity:35/160 - (21%)
Similarity:63/160 - (39%) Gaps:27/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PIANVTVSVGRDALMAC---VVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWY 140
            |...:...||.||.:.|   ...:.:..::.||....:.:::::.:......|.|..|....|..
Human    36 PSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSIL 100

  Fly   141 ----------LHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVV-----R 190
                      |.|..|..:|.|.|:|... |.....|..:::.|..:      .:|:.|     :
Human   101 RDGITAGKAALRIHNVTASDSGKYLCYFQ-DGDFYEKALVELKVAAL------GSDLHVDVKGYK 158

  Fly   191 EGQNISLVCKARG-YPEPYVMWRREDGEEM 219
            :| .|.|.|::.| ||:|.:.|....||.:
Human   159 DG-GIHLECRSTGWYPQPQIQWSNNKGENI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 20/104 (19%)
IG_like 82..174 CDD:214653 20/104 (19%)
IG_like 184..267 CDD:214653 13/42 (31%)
IGc2 191..255 CDD:197706 11/30 (37%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
BTN3A1NP_008979.3 IG_like 37..143 CDD:214653 20/106 (19%)
Ig_MOG_like 45..144 CDD:143190 19/99 (19%)
SPRY_PRY_BTN3 337..512 CDD:293992
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.