DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DIP-kappa and pigrl4.2

DIOPT Version :9

Sequence 1:	NP_723828.1	Gene:	DIP-kappa / 318958	FlyBaseID:	FBgn0051814	Length:	672	Species:	Drosophila melanogaster
Sequence 2:	NP_001293038.1	Gene:	pigrl4.2 / 105665605	ZFINID:	ZDB-GENE-150409-10	Length:	240	Species:	Danio rerio

Alignment Length:	106	Identity:	27/106 - (25%)
Similarity:	45/106 - (42%)	Gaps:	10/106 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    81 ANVTVSVGRDALMACVVENLKGYKV-AWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIK 144
            ::|:...|.|..:.|...:....|: .|.|:|..|.........||||.:.::.:...|:.:.:.
Zfish   129 SSVSGHKGDDVSVRCFYRSAYQNKLKQWCRIDDLTCFREKKTDTSQNSSVQISDDGESSFTVLMT 193

  Fly   145 EVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSN 185
            .:..:|.|||.|.|         |.|||.|...:.:|...|
Zfish   194 GLRLSDSGWYFCSV---------GNLQVPVQLTVYQGENKN 225

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DIP-kappa	NP_723828.1	Ig	80..172	CDD:299845	22/91 (24%)
		IG_like	82..174	CDD:214653	24/92 (26%)
		IG_like	184..267	CDD:214653	1/2 (50%)
		IGc2	191..255	CDD:197706
		IG_like	282..368	CDD:214653
		Ig	288..367	CDD:143165
pigrl4.2	NP_001293038.1	IG_like	26..118	CDD:214653
		Ig_pIgR	30..117	CDD:143193
		Ig	133..217	CDD:299845	24/92 (26%)
		IG_like	136..218	CDD:214653	24/90 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	40	1.000	Domainoid score	I12510
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.000