DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and pigrl4.2

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001293038.1 Gene:pigrl4.2 / 105665605 ZFINID:ZDB-GENE-150409-10 Length:240 Species:Danio rerio


Alignment Length:106 Identity:27/106 - (25%)
Similarity:45/106 - (42%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ANVTVSVGRDALMACVVENLKGYKV-AWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIK 144
            ::|:...|.|..:.|...:....|: .|.|:|..|.........||||.:.::.:...|:.:.:.
Zfish   129 SSVSGHKGDDVSVRCFYRSAYQNKLKQWCRIDDLTCFREKKTDTSQNSSVQISDDGESSFTVLMT 193

  Fly   145 EVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSN 185
            .:..:|.|||.|.|         |.|||.|...:.:|...|
Zfish   194 GLRLSDSGWYFCSV---------GNLQVPVQLTVYQGENKN 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 24/92 (26%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 1/4 (25%)
Ig strand E 139..143 CDD:409353 0/3 (0%)
Ig strand F 153..158 CDD:409353 3/4 (75%)
Ig strand G 165..168 CDD:409353 0/2 (0%)
Ig 176..267 CDD:472250 2/10 (20%)
Ig strand B 195..199 CDD:409301
Ig strand C 208..212 CDD:409301
Ig strand E 232..236 CDD:409301
Ig strand F 246..251 CDD:409301
Ig strand G 260..263 CDD:409301
IG_like 282..368 CDD:214653
Ig strand B 288..292 CDD:409353
Ig strand C 301..305 CDD:409353
Ig strand E 330..340 CDD:409353
Ig strand F 350..355 CDD:409353
Ig strand G 363..366 CDD:409353
pigrl4.2NP_001293038.1 IgV_pIgR_like 30..117 CDD:409381
Ig strand B 32..39 CDD:409381
CDR1 39..47 CDD:409381
Ig strand C 47..52 CDD:409381
FR2 48..52 CDD:409381
CDR2 53..68 CDD:409381
Ig strand C' 61..64 CDD:409381
Ig strand C' 66..68 CDD:409381
FR3 71..102 CDD:409381
Ig strand D 71..77 CDD:409381
Ig strand E 81..89 CDD:409381
Ig strand F 95..102 CDD:409381
CDR3 103..111 CDD:409381
FR4 111..117 CDD:409381
Ig strand G 111..117 CDD:409381
Ig 133..217 CDD:472250 24/92 (26%)
Ig strand B 139..143 CDD:409381 0/3 (0%)
Ig strand C 153..157 CDD:409381 0/3 (0%)
Ig strand E 188..192 CDD:409381 0/3 (0%)
Ig strand F 202..207 CDD:409381 3/4 (75%)
Ig strand G 211..214 CDD:409381 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.