DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and BTN2A2

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001184166.1 Gene:BTN2A2 / 10385 HGNCID:1137 Length:523 Species:Homo sapiens


Alignment Length:242 Identity:51/242 - (21%)
Similarity:98/242 - (40%) Gaps:55/242 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQ---EDSDFPRFAEPI--ANVTVSVG 88
            |::..:.:|..|::..|.|.||.:   |::|.|....:.:   ||.:...|....  |......|
Human    24 LSLCALVSAQFTVVGPANPILAMV---GENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGG 85

  Fly    89 RDALMACVVENLKGY--KVAWVRVDTQ--TILSIHHNVISQNSRISLTYNDHRSWYLHIKEVEET 149
            |:.    ..|.::.|  ::.:|..|..  ::..:.|||.:|                        
Human    86 RER----TEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQ------------------------ 122

  Fly   150 DRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMV---VREGQNISLVCKARG-YPEPYVM 210
            :.|.|.|.     .:..:.|.:.:: .::|.||.|..::   .:|..:|.|.|.:.| ||||..:
Human   123 ENGIYRCY-----FQEGRSYDEAIL-RLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTV 181

  Fly   211 WRREDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYL----CVASN 253
            ||...| |::...:.|::.|.:.|.:...:.:....|:    |..:|
Human   182 WRDPYG-EVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNN 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 15/97 (15%)
IG_like 82..174 CDD:214653 14/95 (15%)
IG_like 184..267 CDD:214653 20/78 (26%)
IGc2 191..255 CDD:197706 19/68 (28%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
BTN2A2NP_001184166.1 IG_like 42..146 CDD:214653 24/140 (17%)
Ig_MOG_like 48..147 CDD:143190 21/132 (16%)
SPRY_PRY_BTN1_2 326..496 CDD:293991
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.