DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and si:ch211-215e19.3

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_002660995.5 Gene:si:ch211-215e19.3 / 100332384 ZFINID:ZDB-GENE-060503-685 Length:280 Species:Danio rerio


Alignment Length:174 Identity:38/174 - (21%)
Similarity:64/174 - (36%) Gaps:44/174 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 YLCVASNGVPPSISK--RVHLRVQFPPMLSIPNQLEGAYLGQDVILEC-HTEAYPASINYW---- 304
            |.||...|.|.::..  .::|.||..|.||:.|.....:.|.:|.::| ::..|......|    
Zfish   114 YWCVVEIGG
PGTLDAGYYLYLTVQSAPDLSVMNSSVSGHEGGNVSVQCFYSSGYKNKTKQWCRVK 178

  Fly   305 -----TTERGDMIISDTSRAGDKYETTSTV--SGYTKYMKLKIRAVGPNDFGTYRCVAKN----- 357
                 ...:.|...:.:.:..|..|:..||  :|.|.           :|.|.|.|.|.|     
Zfish   179 DKSCFPENKTDTFQNSSVQISDDGESCFTVLMTGLTL-----------SDSGWYFCSAGNLQVPV 232

  Fly   358 ----------SLGETDGNIKLDEMPTPTTAIISE--MSLLNRSY 389
                      .|..|..:.|  ::||.....:|.  .::||:.:
Zfish   233 QLTVTKPEPKDLYTTQPSAK--QIPTTVLTTVSRPGTNILNKEH 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845
IG_like 82..174 CDD:214653
IG_like 184..267 CDD:214653 6/21 (29%)
IGc2 191..255 CDD:197706 3/7 (43%)
IG_like 282..368 CDD:214653 20/112 (18%)
Ig 288..367 CDD:143165 19/105 (18%)
si:ch211-215e19.3XP_002660995.5 Ig 51..122 CDD:325142 3/7 (43%)
Ig 149..235 CDD:325142 18/96 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.