DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and si:ch211-9d9.7

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_021322083.1 Gene:si:ch211-9d9.7 / 100150985 ZFINID:ZDB-GENE-060503-422 Length:288 Species:Danio rerio


Alignment Length:288 Identity:60/288 - (20%)
Similarity:106/288 - (36%) Gaps:67/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 IHH--NVISQNSRISLTYNDHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIV- 179
            |.|  ..||.:.:.|.|        :.:.|:..:|..|:.|..         |.|||.|...:. 
Zfish     8 IQHIPEFISDDGKSSFT--------VLMTELTLSDSEWFFCSA---------GDLQVPVQLTVTK 55

  Fly   180 --------------EGLTSNDMVVREGQNISLVCKARGY-----PEPYVMWRREDGEEMLIGG-- 223
                          ||.:::.:.|:.|.::::.|    |     |.....|....||......  
Zfish    56 VIFVCCFCLGVESFEGGSNHTITVKPGGSVTIPC----YYDEKNPPQKKYWYSVIGESRKYTNTT 116

  Fly   224 -EHVNVVD--GELLHITKVSRL----HMAAYLCVASNGVPPSISKRVHLRVQFPPMLSIPNQLEG 281
             |:::|:|  .:.|....:..|    |...|.|....|...:::..:.|:|...|.:|:.|....
Zfish   117 EENLSVIDHPDQSLFTVTMRNLQENKHNGKYYCTVETGQKSNVTYELFLQVHSAPDVSVMNSSVS 181

  Fly   282 AYLGQDVILEC-HTEAYPASINYWTTERGDMIIS----DTSRAGDKYETTSTVSGYTKYMK-LKI 340
            .:.|.||.::| ::..|......|...:.....|    |||::.....:....|.:|..|. |::
Zfish   182 GHEGDDVSVQCFYSSGYKDKQKRWCRYKDQKCFSQKKTDTSQSSSVQISDDGESSFTVLMTGLRL 246

  Fly   341 RAVGPNDFGTYRCVAKNSLGETDGNIKL 368
                 :|.|.:.|    |:|.....:||
Zfish   247 -----SDSGWFFC----SVGHQTIPVKL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 12/55 (22%)
IG_like 82..174 CDD:214653 14/57 (25%)
IG_like 184..267 CDD:214653 18/96 (19%)
IGc2 191..255 CDD:197706 15/77 (19%)
IG_like 282..368 CDD:214653 19/91 (21%)
Ig 288..367 CDD:143165 17/84 (20%)
si:ch211-9d9.7XP_021322083.1 Ig 76..168 CDD:325142 18/95 (19%)
Ig 180..266 CDD:325142 21/95 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.