DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and lrit3b

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_009305418.1 Gene:lrit3b / 100144406 ZFINID:ZDB-GENE-070424-130 Length:487 Species:Danio rerio


Alignment Length:347 Identity:57/347 - (16%)
Similarity:111/347 - (31%) Gaps:147/347 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LSIHHNVISQ------------------NSRISLTYNDHRSWYLHIKEVEETDRGWYM------- 155
            |.:|:|.:::                  ::|:|...||..:.:| ..:..:|.|.:.:       
Zfish   165 LGLHNNRLARIPLLAVRYLRNVTYLDLSSNRLSTLANDLTALWL-FSDSNQTQRSFVLGLQDNPW 228

  Fly   156 ---CQVNT--DPMRSRKGYLQVV--------------VP-----------PIIVEGLTSNDMVVR 190
               |:::|  |..|..:..|.::              ||           |.:|...|....:: 
Zfish   229 VC
DCRLSTLLDISRGPESSLVLLDRFLTCSEPLDLAGVPFQSVELSRCRRPYVVTSATKITALL- 292

  Fly   191 EGQNISLVCKARGYPEPYVMWRREDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGV 255
             |..:.|.|:|.|:|.|.:||.:.                                         
Zfish   293 -GSTVLLRCEATGHPTPALMWIKS----------------------------------------- 315

  Fly   256 PPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASI-NYWTTERGDMIISDTSRA 319
                :||           ::.||  |........|:  ||.:|..: .|         :.::.|.
Zfish   316 ----AKR-----------NLYNQ--GCCKQTQSSLD--TERFPKKLFGY---------VQESPRV 352

  Fly   320 GDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDEMPTPTTAIISEMSL 384
            |.::...|            :..:..:|.|.|||.|:|..|.::..:.|:     ...:::|.:.
Zfish   353 GVRWSVVS------------LNGISYSDAGEYRCRAQNMAGISEAVVSLN-----VVGVMAEYTD 400

  Fly   385 LNRSYDGKRRHRNKFDSANALP 406
            ...|  .:::...|.||....|
Zfish   401 FKNS--DQQQTTTKSDSKRTKP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 15/85 (18%)
IG_like 82..174 CDD:214653 15/101 (15%)
IG_like 184..267 CDD:214653 11/82 (13%)
IGc2 191..255 CDD:197706 9/63 (14%)
IG_like 282..368 CDD:214653 16/86 (19%)
Ig 288..367 CDD:143165 16/79 (20%)
lrit3bXP_009305418.1 LRRNT 51..92 CDD:214470
leucine-rich repeat 69..89 CDD:275380
LRR_8 112..172 CDD:290566 3/6 (50%)
leucine-rich repeat 114..137 CDD:275378
leucine-rich repeat 138..161 CDD:275378
LRR_8 160..214 CDD:290566 8/49 (16%)
LRR_4 160..201 CDD:289563 5/35 (14%)
leucine-rich repeat 162..185 CDD:275378 3/19 (16%)
leucine-rich repeat 186..199 CDD:275378 2/12 (17%)
leucine-rich repeat 215..230 CDD:275378 2/14 (14%)
Ig 278..391 CDD:299845 34/200 (17%)
I-set 279..391 CDD:254352 34/199 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.