DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and sc:d0835

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001108578.1 Gene:sc:d0835 / 100141489 ZFINID:ZDB-GENE-080229-5 Length:286 Species:Danio rerio


Alignment Length:251 Identity:61/251 - (24%)
Similarity:102/251 - (40%) Gaps:67/251 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EDSDFPRFAEPIANVTVSVGRDALMACVVE---NLKGYKVAWVRVDTQTILSIH----------H 120
            |..:..|.|:|:..|   ||.||::.|.::   .:...||.|||:|.:..:.:|          .
Zfish    25 EGYELVRVADPVFAV---VGGDAILPCSIKPNITIVDMKVEWVRLDQEHSVVVHLYEDHEDRIAE 86

  Fly   121 NVISQNSRISLTYNDHRSWYLHIK--EVEETDRGWYMCQVNTDPMRSRKGYLQVVV-----PPII 178
            .:.|...|..|...:.:.....:|  .|:|:|.|.|.|.:::... |....:.|.|     ||:|
Zfish    87 QIQSYRGRTELNPQELQRGNAALKLISVQESDEGVYKCFIHSTSW-SIDTNINVKVEAVGSPPVI 150

  Fly   179 -VEGLTSNDMVVREGQNISLVCKARG-YPEPYVMWRREDGEEMLIGGE----HVNVVDGELLHIT 237
             |:|..|.        .::|.|::.| ||||.:.|.  ||:...:..|    |.| .||..:..|
Zfish   151 TVDGFNSG--------GLNLQCESEGWYPEPDLEWL--DGKRTRLNPETTETHRN-RDGFSVKQT 204

  Fly   238 KVSRLHMAAYLCVASNGVPPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECH 293
             :|..|        .:|       ::|.||          :|....|...:::.|:
Zfish   205 -ISVGH--------KDG-------KIHCRV----------KLRDHLLETQIVISCN 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 24/106 (23%)
IG_like 82..174 CDD:214653 25/106 (24%)
IG_like 184..267 CDD:214653 21/87 (24%)
IGc2 191..255 CDD:197706 18/68 (26%)
IG_like 282..368 CDD:214653 2/12 (17%)
Ig 288..367 CDD:143165 1/6 (17%)
sc:d0835NP_001108578.1 IG_like 38..141 CDD:214653 25/106 (24%)
Ig 41..141 CDD:299845 23/100 (23%)
Ig 142..223 CDD:299845 29/117 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.