DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and negr1

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:359 Identity:104/359 - (28%)
Similarity:165/359 - (45%) Gaps:52/359 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 AQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISL 131
            |.:..||...|  :.|:.|..|..|::.|.:|. ...|.||  ::..:|:....:..|.:.|:|:
 Frog    35 AGQSMDFQWPA--VDNLVVRQGETAMLRCFLEE-GASKGAW--LNRSSIIFAGGDKWSVDPRVSI 94

  Fly   132 TYNDHRSWYLHIKEVEETDRGWYMCQVNTD-PMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNI 195
            ..:..:.:.|.|::|:.:|.|.|.|.|.|: ..|:.:.:|.|.|.|.|.:  .|:||.|.||.|:
 Frog    95 ATSSKQEYSLRIQKVDVSDDGPYTCSVQTEHSPRTLQVHLTVHVSPKIYD--ISSDMTVNEGTNV 157

  Fly   196 SLVCKARGYPEPYVMWRREDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSIS 260
            ||:|.|.|.|||.:.||.........|       .|:.|.|..::|.....|.|.|.|.|.....
 Frog   158 SLICLATGKPEPSISWRHISPSAKQFG-------SGQYLDIYGITRDQAGDYECSAENDVSFPDV 215

  Fly   261 KRVHLRVQFPPMLSIPNQLE----GAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRA-- 319
            |:|.:.|.|.|.:     ||    |..||:..::.|.|.|.||.:..|  .:|:..:::..|.  
 Frog   216 KKVKVTVNFAPTI-----LEITPTGVSLGRTGLIRCETAAVPAPVFEW--YKGEKKLTNGQRGIR 273

  Fly   320 GDKYETTS--TVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDEM--PTPTTAIIS 380
            ...|.|.|  |||..|:           ..||.|.|||.|.||.::.::.|:::  |:.|:.:.|
 Frog   274 IQNYNTRSILTVSNVTE-----------EHFGNYTCVAVNKLGTSNASLPLNQIIEPSTTSPVTS 327

  Fly   381 EMSLLNRSYDGKRRHRNKFD----SANALPDYGV 410
                 :..|..|...|:..|    :|.:...||:
 Frog   328 -----SAKYSVKHYARSSSDKPHYAAPSTAQYGI 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 24/92 (26%)
IG_like 82..174 CDD:214653 25/92 (27%)
IG_like 184..267 CDD:214653 29/82 (35%)
IGc2 191..255 CDD:197706 22/63 (35%)
IG_like 282..368 CDD:214653 26/89 (29%)
Ig 288..367 CDD:143165 24/82 (29%)
negr1XP_031755650.1 Ig 44..136 CDD:416386 25/96 (26%)
FR1 44..62 CDD:409353 5/19 (26%)
Ig strand A' 47..53 CDD:409353 2/5 (40%)
Ig strand B 55..63 CDD:409353 2/7 (29%)
CDR1 63..68 CDD:409353 1/5 (20%)
FR2 69..75 CDD:409353 3/7 (43%)
Ig strand C 69..74 CDD:409353 3/6 (50%)
CDR2 76..87 CDD:409353 1/10 (10%)
Ig strand C' 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
FR3 88..122 CDD:409353 9/33 (27%)
Ig strand D 91..98 CDD:409353 2/6 (33%)
Ig strand E 101..107 CDD:409353 1/5 (20%)
Ig strand F 114..122 CDD:409353 3/7 (43%)
CDR3 123..127 CDD:409353 1/3 (33%)
Ig strand G 127..136 CDD:409353 2/8 (25%)
FR4 129..136 CDD:409353 1/6 (17%)
Ig_3 140..208 CDD:404760 27/76 (36%)
Ig strand A' 146..151 CDD:409353 3/4 (75%)
Ig strand B 157..164 CDD:409353 3/6 (50%)
Ig strand C 170..175 CDD:409353 1/4 (25%)
Ig strand C' 177..179 CDD:409353 0/1 (0%)
Ig strand E 187..193 CDD:409353 2/5 (40%)
Ig strand F 200..207 CDD:409353 2/6 (33%)
Ig strand G 214..222 CDD:409353 2/7 (29%)
Ig_3 226..302 CDD:404760 27/93 (29%)
putative Ig strand A 226..232 CDD:409353 3/10 (30%)
Ig strand B 242..246 CDD:409353 0/3 (0%)
Ig strand C 255..259 CDD:409353 1/5 (20%)
Ig strand E 281..285 CDD:409353 1/3 (33%)
Ig strand F 295..300 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.