DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and lsamp

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_031751462.1 Gene:lsamp / 100124984 XenbaseID:XB-GENE-5759171 Length:368 Species:Xenopus tropicalis


Alignment Length:406 Identity:113/406 - (27%)
Similarity:171/406 - (42%) Gaps:78/406 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLQAEFNVRQLAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEPIANV 83
            |.||:.|  ||.:.::  ..:.:|.|..|.                    ...||.|..:   |:
 Frog     4 RSQADRN--QLPLLLL--RLLCLLPTGLPV--------------------RSGDFNRSTD---NI 41

  Fly    84 TVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIKEVEE 148
            ||..|..|::.|.||: :..:|||  ::...|:....:..|.:.|:.|.......:.|.|::|:.
 Frog    42 TVRQGDTAILRCFVED-RSSRVAW--LNRSGIIFAGDDKWSLDPRVELEKRSLLEYSLRIQKVDV 103

  Fly   149 TDRGWYMCQVNT-DPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWR 212
            :|.|.|.|.|.| ...::.:.||.|.|||.|..  .|.|:.|.||.|::|:|.|.|.|||.:.||
 Frog   104 SDEGPYTCSVQTKQHTKTTQVYLIVQVPPKISN--ISADITVNEGSNVTLMCIAYGRPEPMITWR 166

  Fly   213 -----------RE-DGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKRVHL 265
                       |: :|||             |.|.|..::|.....|.|.|:|.|..:..|:|.:
 Frog   167 HLTPTAGTSPARDFEGEE-------------EFLEIQGITREQSGRYECKAANEVASADVKQVRV 218

  Fly   266 RVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDT------SRAGDKYE 324
            .|.:||:::.....| |..|:..||.|...|.||....|..:       ||      |..|.:..
 Frog   219 TVNYPPIITESKSNE-ATTGKQAILRCEASAVPAPDFEWYKD-------DTRSRRINSAQGLEIR 275

  Fly   325 TTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDEMPTPTTAIISEMSLLNRSY 389
            .|.:.|      .|.:..|....:|.|.|||.|.||.|:.::.|.:..:||..:.:.....|..|
 Frog   276 NTGSRS------VLMVANVTEEHYGNYTCVAANKLGITNTSLYLYKRVSPTKPMSASERGSNVHY 334

  Fly   390 DGKRRHRNKFDSANAL 405
            ..|.......|||.:|
 Frog   335 QYKVGPGTPIDSATSL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 26/92 (28%)
IG_like 82..174 CDD:214653 27/92 (29%)
IG_like 184..267 CDD:214653 30/94 (32%)
IGc2 191..255 CDD:197706 24/75 (32%)
IG_like 282..368 CDD:214653 26/91 (29%)
Ig 288..367 CDD:143165 24/84 (29%)
lsampXP_031751462.1 Ig 38..128 CDD:416386 26/95 (27%)
FR1 38..54 CDD:409353 5/18 (28%)
Ig strand A' 39..45 CDD:409353 3/8 (38%)
Ig strand B 47..55 CDD:409353 2/7 (29%)
CDR1 55..59 CDD:409353 2/4 (50%)
FR2 60..67 CDD:409353 3/8 (38%)
Ig strand C 60..66 CDD:409353 3/7 (43%)
CDR2 68..78 CDD:409353 1/9 (11%)
Ig strand C' 70..73 CDD:409353 1/2 (50%)
Ig strand C' 75..78 CDD:409353 0/2 (0%)
FR3 79..114 CDD:409353 10/34 (29%)
Ig strand D 83..90 CDD:409353 2/6 (33%)
Ig strand E 93..99 CDD:409353 1/5 (20%)
Ig strand F 106..114 CDD:409353 3/7 (43%)
CDR3 115..119 CDD:409353 1/3 (33%)
Ig strand G 119..128 CDD:409353 2/8 (25%)
FR4 121..128 CDD:409353 2/6 (33%)
Ig_3 131..206 CDD:404760 29/89 (33%)
Ig strand A' 138..143 CDD:409353 2/4 (50%)
Ig strand B 149..156 CDD:409353 2/6 (33%)
Ig strand C 162..167 CDD:409353 1/4 (25%)
Ig strand C' 173..175 CDD:409353 0/1 (0%)
Ig strand E 185..191 CDD:409353 3/5 (60%)
Ig strand F 198..205 CDD:409353 2/6 (33%)
Ig strand G 212..220 CDD:409353 2/7 (29%)
Ig_3 223..302 CDD:404760 25/92 (27%)
putative Ig strand A 224..230 CDD:409353 1/5 (20%)
Ig strand B 240..244 CDD:409353 2/3 (67%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 2/9 (22%)
Ig strand F 295..300 CDD:409353 2/4 (50%)
Ig strand G 308..311 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.