DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and IFA38

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_009717.1 Gene:IFA38 / 852456 SGDID:S000000363 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:341 Identity:96/341 - (28%)
Similarity:173/341 - (50%) Gaps:46/341 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IYIVGSLSIVAYLYENLKSLFSIIKSVVEPFFRP--NLPKTLAEKFGNWAVVTGATDGIGKEYAR 74
            :::|..|.::.....:|:.|..|.    :.|..|  |..| ...|.|.:..:|||:||||||:||
Yeast    21 LWVVFGLGVLKCTTLSLRFLALIF----DLFLLPAVNFDK-YGAKTGKYCAITGASDGIGKEFAR 80

  Fly    75 ELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREV-YAHIEKELNGIEVGILV 138
            ::|::|.||||:||.:.||.|:..|:..|::|.:|.:..|.|:.:|. |..|::....:.:.:||
Yeast    81 QMAKRGFNLVLISRTQSKLEALQKELEDQHHVVVKILAIDIAEDKESNYESIKELCAQLPITVLV 145

  Fly   139 NNVGTIHD-PESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMI---------SRRKGAIVNLGS 193
            ||||..|. |....:..|..|.:::|:|..:..::|:.|.|:::         |..:|.|:.:||
Yeast   146 NNVGQSHSIPVPFLETEEKELRNIITINNTATLLITQIIAPKIVETVKAENKKSGTRGLILTMGS 210

  Fly   194 SSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFP 258
            ...|.|.|.|..|:.:|.|:..::..|..|:::..|.|:|::...|.::|:    |:|:..|:.|
Yeast   211 FGGLIPTPLLATYSGSKSFLQGWSNSLAGELSKDAIDVELIISYLVTSSMS----KIRRSSLMIP 271

  Fly   259 NAYSYARSAVFTLGKT-------SETNGFWVHGLQYAFMKLAPMDIRTYFG----------YQLF 306
            |...:.:|.:.::|:.       :....:|.|.: |.|:      |...||          |...
Yeast   272 NPQQFVKSTLRSVGRRCGSQERYATMTPYWAHAV-YQFV------ITETFGVYSKIVNSINYSFH 329

  Fly   307 KRMRIEAMEHRLKNQK 322
            |.:||.|::...:..|
Yeast   330 KSIRIRALKKAARQVK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 92/327 (28%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 77/258 (30%)
IFA38NP_009717.1 17beta-HSD1_like_SDR_c 62..310 CDD:187614 77/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I1199
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I1076
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 1 1.000 - - otm46689
orthoMCL 1 0.900 - - OOG6_100431
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.