DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and KCR1

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_564905.1 Gene:KCR1 / 843098 AraportID:AT1G67730 Length:318 Species:Arabidopsis thaliana


Alignment Length:309 Identity:103/309 - (33%)
Similarity:181/309 - (58%) Gaps:19/309 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IYIVGSLSIVAYLYENLKSLFSIIKSVVEPFFRPNLPKTLAEKFGNWAVVTGATDGIGKEYAREL 76
            ::::||:||       .|.:|::::|....|.||:  |.| .::|:||::||.||||||.:|.:|
plant    17 LFVLGSISI-------FKFIFTLLRSFYIYFLRPS--KNL-RRYGSWAIITGPTDGIGKAFAFQL 71

  Fly    77 ARQGLNLVLVSRKEEKLIAVTNEIGSQYN-VKIKWIVADFAKG-REVYAHIEKELNGIEVGILVN 139
            |::||||:||:|..:||..|::.|.|:|: .:|..:|.||:.. .|....|::.:.|::||||:|
plant    72 AQKGLNLILVARNPDKLKDVSDSIRSKYSQTQILTVVMDFSGDIDEGVKRIKESIEGLDVGILIN 136

  Fly   140 NVGTIHD-PESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSE--LQPHP 201
            |.|..:. .:...:|.|:::.:|:.:||...|.:|:.:||.|:.|:||||:|:||.:.  :..:|
plant   137 NAGMSYPYAKYFHEVDEELINNLIKINVEGTTKVTQAVLPNMLKRKKGAIINMGSGAAALIPSYP 201

  Fly   202 NLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARS 266
            ..:.||..|.:|..|||.|..|..:..|.||..:|.:|||.|.    |:|:...|..:...||::
plant   202 FYSVYAGAKTYVDQFTKCLHVEYKKSGIDVQCQVPLYVATKMT----KIRRASFLVASPEGYAKA 262

  Fly   267 AVFTLGKTSETNGFWVHGLQYAFMKLAPMDIRTYFGYQLFKRMRIEAME 315
            |:..:|..::...:|.|.|..|.:...|..:...|..:...::|.:.::
plant   263 ALRFVGYEAQCTPYWPHALMGAVVSALPESVFESFNIKRCLQIRKKGLQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 102/302 (34%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 89/245 (36%)
KCR1NP_564905.1 PLN02780 1..318 CDD:166421 103/309 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 153 1.000 Domainoid score I1365
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 1 1.000 - - mtm1136
orthoMCL 1 0.900 - - OOG6_100431
Panther 1 1.100 - - O PTHR43899
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.