DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and KCR2

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_173856.1 Gene:KCR2 / 839063 AraportID:AT1G24470 Length:312 Species:Arabidopsis thaliana


Alignment Length:251 Identity:97/251 - (38%)
Similarity:151/251 - (60%) Gaps:6/251 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PKTLAEKFGNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQY-NVKIKWI 111
            ||.| :::|:||:|||||:|||:.:|.|||:.||||:||||...||.:|:::...:: ::|||.|
plant    45 PKRL-KRYGSWAMVTGATEGIGRAFAHELAKHGLNLILVSRNLSKLESVSDDFQQEFPHIKIKII 108

  Fly   112 VADFAKGREVYAHIEKELNGIEVGILVNNVGTIHDPESLDKVSEDMLW-DLLTVNVGSVTMLTRK 175
            ..||: ....|..||:.:.|:|||||:||||..:.........:.:.| .:|.||:.:.|.:||.
plant   109 PFDFS-SEGGYGAIEEGIKGLEVGILINNVGITYPRAMFFHEVDQLTWTKILRVNLEATTWVTRS 172

  Fly   176 ILPQMISRRKGAIVNL--GSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAF 238
            ::..|:.||:|||||:  |::..:..||....|||||.:|...::.|..|..:..|.||..:|.:
plant   173 LIGPMLHRRRGAIVNISSGAAVVVPSHPLYAIYAATKAYVDALSRSLHVEYKQFGIDVQCQVPLY 237

  Fly   239 VATNMNSYSDKVRQGGLLFPNAYSYARSAVFTLGKTSETNGFWVHGLQYAFMKLAP 294
            |:|.|.|....:.:..|..|:...||::||..:|..|..:.||.|.||:..:.|.|
plant   238 VSTRMVSEVAAIDKPSLFVPSPEVYAKAAVAQIGIGSRCSPFWAHSLQWFLVGLVP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 97/251 (39%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 94/243 (39%)
KCR2NP_173856.1 PLN02780 8..309 CDD:166421 97/251 (39%)
17beta-HSD1_like_SDR_c 52..293 CDD:187614 93/241 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 153 1.000 Domainoid score I1365
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H100660
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 1 1.000 - - mtm1136
orthoMCL 1 0.900 - - OOG6_100431
Panther 1 1.100 - - O PTHR43899
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.