DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and HSDL1

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_113651.4 Gene:HSDL1 / 83693 HGNCID:16475 Length:330 Species:Homo sapiens


Alignment Length:303 Identity:124/303 - (40%)
Similarity:187/303 - (61%) Gaps:5/303 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SLSIVAYLYENLKSLFSI--IKSVVEPFFRPNLPK--TLAEKFGNWAVVTGATDGIGKEYARELA 77
            :|::|...|...||:..|  ..|::...|.|.|..  .|.:::|.||||:||||||||.||.|||
Human    24 ALALVGAWYTARKSITVICDFYSLIRLHFIPRLGSRADLIKQYGRWAVVSGATDGIGKAYAEELA 88

  Fly    78 RQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEVGILVNNVG 142
            .:|||::|:||.||||..|..:|...|.|:...|||||:.|||:|..|.:.|...:|||||||||
Human    89 SRGLNIILISRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREALKDKDVGILVNNVG 153

  Fly   143 TIHD-PESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTAY 206
            ..:. |:...::|||.|||::.||:.:.:::...:||.|:.|:|||||.:.|.|..:|.|.|.|:
Human   154 VFYPYPQYFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVERKKGAIVTISSGSCCKPTPQLAAF 218

  Fly   207 AATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARSAVFTL 271
            :|:|.::.||::.|:||.|...|.||.::|.:|||:|.:.|:.:.:...|.|:...||..||.||
Human   219 SASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSMTAPSNFLHRCSWLVPSPKVYAHHAVSTL 283

  Fly   272 GKTSETNGFWVHGLQYAFMKLAPMDIRTYFGYQLFKRMRIEAM 314
            |.:..|.|:|.|.:|:.|.:..|..:..:....|.:.:|.||:
Human   284 GISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEAL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 121/297 (41%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 109/241 (45%)
HSDL1NP_113651.4 Required for mitochondria translocation 2..82 23/57 (40%)
17beta-HSD1_like_SDR_c 67..309 CDD:187614 109/241 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141586
Domainoid 1 1.000 189 1.000 Domainoid score I3291
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H100660
Inparanoid 1 1.050 230 1.000 Inparanoid score I3445
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 1 1.000 - - otm40861
orthoMCL 1 0.900 - - OOG6_100431
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17415
SonicParanoid 1 1.000 - - X3003
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.700

Return to query results.
Submit another query.