DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and AT3G55310

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_191091.2 Gene:AT3G55310 / 824697 AraportID:AT3G55310 Length:279 Species:Arabidopsis thaliana


Alignment Length:204 Identity:50/204 - (24%)
Similarity:102/204 - (50%) Gaps:19/204 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KTLAEKFGNW-------AVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNV 106
            :|:.::...|       .:||||:.|||:|...:||:.|..::..:|:.::|.::.:||.|..:.
plant     5 QTVLKQLEPWCELKDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLCSEINSFSST 69

  Fly   107 KIKWIVADFAKGREVYAHIEKELNGI-----EVGILVNNVGTIHDPE-SLDKVSEDMLWD-LLTV 164
            .|:....:.....:. |.|:|.:...     ::..|:||.|...:.: ||| :|||. || :...
plant    70 GIQAAALELDVSSDA-ATIQKAVREAWDIFGKIDALINNAGIRGNVKLSLD-LSEDE-WDNVFNT 131

  Fly   165 NVGSVTMLTRKILPQM-ISRRKGAIVNLGSSSELQP-HPNLTAYAATKKFVTHFTKGLEYEVAEH 227
            |:....::.:.:...| .::|.|:::|:.|.:.::. .|...||:.:|..|...::.:..|:..|
plant   132 NLKGPWLVAKYVCVLMRDAKRGGSVINISSVAGVRSIVPGGLAYSCSKGGVDTMSRMMAIELGVH 196

  Fly   228 NIHVQLVMP 236
            .|.|..:.|
plant   197 KIRVNSIAP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 50/204 (25%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 49/197 (25%)
AT3G55310NP_191091.2 SDR_c 22..265 CDD:212491 48/187 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.