DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and SDR5

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_566097.1 Gene:SDR5 / 819327 AraportID:AT2G47140 Length:257 Species:Arabidopsis thaliana


Alignment Length:230 Identity:52/230 - (22%)
Similarity:88/230 - (38%) Gaps:43/230 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGRE 120
            |...::||...|||.|..|.....|..:|:|.        |.:|:|....|.|       .:.:.
plant     8 GKIVIITGGASGIGAESVRLFTEHGARVVIVD--------VQDELGQNVAVSI-------GEDKA 57

  Fly   121 VYAHI----EKEL-NGI--------EVGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTML 172
            .|.|.    |.|: |.:        ::.:|.:|.|.|....|:..::.:.|...:.:|:......
plant    58 SYYHCDVTNETEVENAVKFTVEKYGKLDVLFSNAGVIEPFVSILDLNLNELDRTIAINLRGTAAF 122

  Fly   173 TRKILPQMISRR-KGAIVNLGS-SSEL---QPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQ 232
            .:.....|:.:. :|:||...| ::|:   .||    .|..:|..:....|.....:.::.|.|.
plant   123 IKHAARAMVEKGIRGSIVCTTSVAAEIAGTAPH----GYTTSKHGLLGLIKSASGGLGKYGIRVN 183

  Fly   233 LVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARSA 267
            .|.|..|||.:      |..|..:.||......||
plant   184 GVAPFGVATPL------VCNGFKMEPNVVEQNTSA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 52/230 (23%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 52/230 (23%)
SDR5NP_566097.1 PLN02253 1..255 CDD:177895 52/230 (23%)
NADB_Rossmann 5..253 CDD:304358 52/230 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.