DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and Hsd17b12

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_062631.1 Gene:Hsd17b12 / 56348 MGIID:1926967 Length:312 Species:Mus musculus


Alignment Length:320 Identity:118/320 - (36%)
Similarity:186/320 - (58%) Gaps:29/320 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IYIVGSLSIVAYLYENLKSLFSIIKSVV------EPFFRPNLPKTLAEKFGNWAVVTGATDGIGK 70
            :|.||: |.:|||  .|::.:|:.::..      |....|.|        |.||||||.||||||
Mouse    11 LYWVGA-STIAYL--ALRASYSLFRAFQVWCVGNEALVGPRL--------GEWAVVTGGTDGIGK 64

  Fly    71 EYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEVG 135
            .||.|||::|:.:||:||.::||..|:|.|..::||:.:.|..||:.. ::|..|:..|:|:|:|
Mouse    65 AYAEELAKRGMKIVLISRSQDKLNQVSNNIKEKFNVETRTIAVDFSLD-DIYDKIKTGLSGLEIG 128

  Fly   136 ILVNNVGTIHD-PESLDKVS--EDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSEL 197
            :||||||..:: ||...::.  ::.:..|:.:||.||..:||.:||.|:.|.||.|:|:.|:|.:
Mouse   129 VLVNNVGMSYEYPEYFLEIPDLDNTIKKLININVLSVCKVTRLVLPGMVERSKGVILNISSASGM 193

  Fly   198 QPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNAYS 262
            .|.|.||.|:|||.||..|::.|..|.....|.||.|||..|||.:    .|:::..|..|:|.:
Mouse   194 LPVPLLTIYSATKAFVDFFSQCLHEEYKSKGIFVQSVMPYLVATKL----AKIQKPTLDKPSAET 254

  Fly   263 YARSAVFTLGKTSETNGFWVHGLQYAFMKLAP--MDIRTYFGYQLFKRMRIEAMEHRLKN 320
            :.:||:.|:|..:.|.|:.:|.|..:...:.|  |..:...|:.  |.:|...::.|.||
Mouse   255 FVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFS--KSLRNRYLKKRKKN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 114/308 (37%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 100/245 (41%)
Hsd17b12NP_062631.1 NADB_Rossmann <4..>83 CDD:304358 34/82 (41%)
DltE 46..305 CDD:223377 105/273 (38%)
17beta-HSD1_like_SDR_c 50..288 CDD:187614 99/242 (41%)
Di-lysine motif. /evidence=ECO:0000250 308..312 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100431
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.