DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and hsd17b12

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001017234.1 Gene:hsd17b12 / 549988 XenbaseID:XB-GENE-945229 Length:320 Species:Xenopus tropicalis


Alignment Length:307 Identity:112/307 - (36%)
Similarity:175/307 - (57%) Gaps:30/307 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSIVAYLYENLKSLFSIIKSV----------VEPFFRPNLPKTLAEKFGNWAVVTGATDGIGKEY 72
            |.:||.::..|::.:.::...          |.|            :.|.|||||||||||||.|
 Frog    20 LGVVAAVWWGLRAAWCLLDGARVWVLGSGAQVGP------------RIGKWAVVTGATDGIGKAY 72

  Fly    73 ARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEVGIL 137
            |.|||::|:|:||:||..|||..|..:|..::.|:.|.|.|||.|..|:|..||..|..:|:|:|
 Frog    73 AEELAKRGMNIVLISRSPEKLEEVAKQIKEKFKVETKIIAADFGKPTEIYGRIESGLRDLEIGVL 137

  Fly   138 VNNVGTIHD-PESLDKVS--EDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQP 199
            |||||..:: ||...::.  |:.|..::.:|:.||..:||.:||.|:.|.:|.|:|:.|:|.:.|
 Frog   138 VNNVGVSYEHPEYFLEIPDLENTLDKMININITSVCQMTRLVLPGMLGRGRGVILNISSASGMYP 202

  Fly   200 HPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYA 264
            .|.||.|:|||.||..|::||:.|.....:.||.|:|.:|||.:    .|:|:.....|:..:|.
 Frog   203 VPLLTVYSATKAFVDFFSRGLQAEYRSKGVTVQSVLPFYVATKL----AKIRKPTWDKPSPETYV 263

  Fly   265 RSAVFTLGKTSETNGFWVHGLQ-YAFMKLAPMDIRTYFGYQLFKRMR 310
            :||:.|:|..::|||:..|.:. :....|.|:......|.::.|.:|
 Frog   264 QSALNTVGLQTQTNGYLPHAIMGWISTSLVPVSTAISLGMKMNKGLR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 111/305 (36%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 103/244 (42%)
hsd17b12NP_001017234.1 17beta-HSD1_like_SDR_c 56..297 CDD:187614 103/244 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.