DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and HSD17B12

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_057226.1 Gene:HSD17B12 / 51144 HGNCID:18646 Length:312 Species:Homo sapiens


Alignment Length:324 Identity:122/324 - (37%)
Similarity:181/324 - (55%) Gaps:37/324 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IYIVGSLSIVAYLYENLK-SLFSIIKSVV-----EPFFRPNLPKTLAEKFGNWAVVTGATDGIGK 70
            :|.||: ..||||...:. |||:.::  |     |....|.|        |.||||||:||||||
Human    11 LYWVGA-GTVAYLALRISYSLFTALR--VWGVGNEAGVGPGL--------GEWAVVTGSTDGIGK 64

  Fly    71 EYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEVG 135
            .||.|||:.|:.:||:||.::||..|::||..::.|:.:.|..||| ..::|..|:..|.|:|:|
Human    65 SYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFA-SEDIYDKIKTGLAGLEIG 128

  Fly   136 ILVNNVGTIHD-PE------SLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGS 193
            |||||||..:: ||      .||.|.:.|    :.:|:.||..:|:.:||.|:.|.||||:|:.|
Human   129 ILVNNVGMSYEYPEYFLDVPDLDNVIKKM----ININILSVCKMTQLVLPGMVERSKGAILNISS 189

  Fly   194 SSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFP 258
            .|.:.|.|.||.|:|||.||..|::.|..|.....:.||.|:|.||||.:    .|:|:..|..|
Human   190 GSGMLPVPLLTIYSATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKL----AKIRKPTLDKP 250

  Fly   259 NAYSYARSAVFTLGKTSETNGFWVHGLQYAFMKLAPMDIRTYFGYQLFKRMRIEAMEHRLKNQK 322
            :..::.:||:.|:|..|.|||:.:|.|..:.:...|    ::...::...|......|.||..|
Human   251 SPETFVKSAIKTVGLQSRTNGYLIHALMGSIISNLP----SWIYLKIVMNMNKSTRAHYLKKTK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 117/310 (38%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 103/247 (42%)
HSD17B12NP_057226.1 NADB_Rossmann <3..>83 CDD:304358 36/82 (44%)
DltE 50..300 CDD:223377 104/262 (40%)
17beta-HSD1_like_SDR_c 50..289 CDD:187614 103/251 (41%)
Di-lysine motif 308..312 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100431
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.