DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and hsdl1

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001008607.1 Gene:hsdl1 / 494064 ZFINID:ZDB-GENE-041212-31 Length:319 Species:Danio rerio


Alignment Length:285 Identity:87/285 - (30%)
Similarity:156/285 - (54%) Gaps:7/285 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VGSLSIVAYLYENLKSLFSI--IKSVVEPFFRPNL--PKTLAEKFGNWAVVTGATDGIGKEYARE 75
            |.:|::|...|...|::..:  ..|::..:|.|.|  .:.|::::|.||::.||::.|.|.||.|
Zfish    22 VETLALVGACYMASKTVIFMRDCYSLIRLYFVPRLVRHRDLSQQYGQWAIICGASEAIAKAYAEE 86

  Fly    76 LARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEVGILVNN 140
            |||.|:.::|:|:....:......|.:.|.|:...|.|||.:|......|:..::..::|.:||:
Zfish    87 LARHGICVILISKDLSSVSDTARLISNNYGVEAICIEADFNQGPSACKPIKDAISSKDIGFIVNS 151

  Fly   141 V-GTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLT 204
            . ||:...::..::||.:||..:..|:.:.|::||..||.|:.|.:||:||:.|.....|.|...
Zfish   152 FDGTLEISQNFLELSESVLWGTIDRNIAATTLVTRLALPAMMERGRGAVVNISSGHCFHPIPRKA 216

  Fly   205 AYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYARSAVF 269
            |::|:..|:.:|::.|:||..:..:.||.::|..||:.....|  ......|.|:...||..|:.
Zfish   217 AFSASTAFLDNFSRSLQYEYGDQGVFVQSLLPFRVASQRPEGS--APPASWLVPSPQVYASHALS 279

  Fly   270 TLGKTSETNGFWVHGLQYAFMKLAP 294
            |||.:..|.|:|.|.:|...:|:.|
Zfish   280 TLGISHRTTGYWPHSMQLGLVKMMP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 87/285 (31%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 77/240 (32%)
hsdl1NP_001008607.1 Required for mitochondria translocation. /evidence=ECO:0000250 2..82 16/59 (27%)
17beta-HSD1_like_SDR_c 67..307 CDD:187614 77/240 (32%)
adh_short 68..248 CDD:278532 57/179 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574573
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H100660
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3003
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.