DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and hsd20b2

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001373557.1 Gene:hsd20b2 / 368367 ZFINID:ZDB-GENE-030804-21 Length:329 Species:Danio rerio


Alignment Length:327 Identity:125/327 - (38%)
Similarity:178/327 - (54%) Gaps:47/327 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VGSLSIVAYL-------YENLKSLFSIIKSVVEPFFRPNLPKTLAEKFGNWAVVTGATDGIGKEY 72
            :|.:::|.|:       :...|..      |:...:|.:|     ..:|.||||||||.|||:.|
Zfish    17 IGCVTVVYYMLRWSWQCWHGFKVY------VISEIWRTDL-----RTYGRWAVVTGATSGIGRAY 70

  Fly    73 ARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKELNGIEVGIL 137
            |.|||::|||:||:||.||||..|..||..:||.|...|.|||.:|..:|:.|.|:|.|:|:|||
Zfish    71 AEELAKRGLNIVLISRSEEKLHRVAKEIEDKYNQKTHVIQADFTEGHSIYSTITKQLEGLEIGIL 135

  Fly   138 VNNVG-----------TIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNL 191
            |||||           .:.||       :..:..:|..|..|||.:.|.|||.|:.|.||.|:|:
Zfish   136 VNNVGMNYIGVLANFLDVPDP-------DQRITQVLNCNTLSVTQMCRVILPGMVERGKGLIINI 193

  Fly   192 GSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLL 256
            .|.:..||.|.::.|:|||.|||:|:.||..|.....|.||.|.|..|:||| :::..|..   |
Zfish   194 SSEAGYQPVPMVSLYSATKAFVTYFSLGLNAEYRSKGITVQCVAPFMVSTNM-THNVPVNP---L 254

  Fly   257 FPNAYSYARSAVFTLGKTSETNGFWVHGLQYAFMKLA-PMDIR-TYFGYQLFKRMRIEAMEHRLK 319
            ..:|.|:||.|:.|:|.|:.|:|...|.||:..:.:. |..:| |.|..|     |:|....|::
Zfish   255 VKSAASFARDALNTVGYTTYTSGCLTHALQHIVLSIVFPGWLRLTSFCVQ-----RMEKFARRIE 314

  Fly   320 NQ 321
            .|
Zfish   315 PQ 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 121/314 (39%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 110/252 (44%)
hsd20b2NP_001373557.1 17beta-HSD1_like_SDR_c 54..296 CDD:187614 110/252 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.