DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and CG2064

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster


Alignment Length:213 Identity:50/213 - (23%)
Similarity:100/213 - (46%) Gaps:33/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EKFGNWAVVTGATDGIGKEYARELARQGLNLVL----VSRKEEKLIAVTNEIGSQYNVKIKWIVA 113
            ::.|...:||||..|||||.|.|:||:|..:.|    ::|.|:....:..|..:| |:       
  Fly    40 DETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQ-NI------- 96

  Fly   114 DFAKGREVYA--HIEKELNGI-----EVGILVNNVGTIHDPESLDK-----------VSEDMLWD 160
             |::..::.:  .|.|.::|.     ::.:|:||.|.:..|::|.|           :...:|.:
  Fly    97 -FSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTN 160

  Fly   161 LLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVA 225
            || ::|...:..:|.::...::..:|:| |:...:..:.:....||:.:|.....||:.|...:.
  Fly   161 LL-LDVLKNSAPSRIVVVSSLAHARGSI-NVADLNSEKSYDEGLAYSQSKLANVLFTRELAKRLE 223

  Fly   226 EHNIHVQLVMPAFVATNM 243
            ...:.|..:.|..|.|.:
  Fly   224 GSGVTVNALHPGVVDTEL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 50/213 (23%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 50/210 (24%)
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 50/213 (23%)
NADB_Rossmann 43..317 CDD:304358 50/210 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447683
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.