DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and CG30491

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster


Alignment Length:307 Identity:72/307 - (23%)
Similarity:117/307 - (38%) Gaps:85/307 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SLFSIIKSVVE------------PFFRPNLPK-----TLAEKFGNWAVVTGATDGIGKEYARELA 77
            |||:.:||...            .||..:|.:     ....:.|...:||||..|||||..||:|
  Fly     2 SLFAFLKSRTAFWLSFTGTTTGLAFFVKDLMQGGQFTKETNETGKVFIVTGANTGIGKETVREIA 66

  Fly    78 RQGLNLVLVSR--------KEEKLIAVTN--------EIGSQYNVKIKWIVADFAKGREVYAHIE 126
            ::|..:.:..|        :||.::...|        ::.||.:  |:..||.|.:.:|   |:.
  Fly    67 KRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQES--IRHFVAAFKREQE---HLH 126

  Fly   127 KELNGIEVGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNL 191
                     :|:||.|.:..|.||   :.|.:...|.||.....:||..:|..:.......|||:
  Fly   127 ---------VLINNAGVMRCPRSL---TSDGIELQLGVNHMGHFLLTNLLLDLLKKSSPSRIVNV 179

  Fly   192 GSSSELQPHPNL------------TAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMN 244
            .|.:..:...|.            .||:.:|.....||:.|...:...|:....:.|..|.|.: 
  Fly   180 SSLAHTRGEINTGDLNSDKSYDEGKAYSQSKLANVLFTRELAKRLEGTNVTANALHPGVVDTEI- 243

  Fly   245 SYSDKVRQGGLLFPNAYSYARSAVFTLGKTSETNGFWVHGLQYAFMK 291
                 :|..| .|.|.::                |.:|..|.:.|:|
  Fly   244 -----IRHMG-FFNNFFA----------------GLFVKPLFWPFVK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 72/307 (23%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 64/264 (24%)
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 64/266 (24%)
NADB_Rossmann 45..319 CDD:304358 64/264 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447681
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.