DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and CG6012

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster


Alignment Length:305 Identity:138/305 - (45%)
Similarity:195/305 - (63%) Gaps:8/305 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ISTGIYIVGSLSIVAYLYENLKSLFSIIKSVVEPFFRPNLPKTLAEKFGNWAVVTGATDGIGKEY 72
            :|..:..||..::.:||||.|::.:.:||.   .:|....| ||.|:||:||.||||:|||||||
  Fly     5 LSAFLTFVGVYALSSYLYEQLRTPYKLIKI---RYFSGTRP-TLKERFGDWAAVTGASDGIGKEY 65

  Fly    73 ARELARQGLNLVLVSRKEEKLIAVTNEIGS-QYNVKIKWIVADFAKGREVYAHIEKELNGIEVGI 136
            |:|||||.:|:||::|.||||.||..||.. ...|:.|.::|||.||.:||.|||||...|.:.|
  Fly    66 AKELARQNINVVLIARTEEKLQAVAKEIADCGAGVQTKIVIADFTKGSQVYEHIEKETANIPISI 130

  Fly   137 LVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQM-ISRRKGAIVNLGSSSELQPH 200
            |||||| |..|:||.|.:::...:::..||.:|:.|:|....:| .|:.||||||:||.:||||.
  Fly   131 LVNNVG-IATPKSLLKYNQEETQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTELQPL 194

  Fly   201 PNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFPNAYSYAR 265
            ||...|||:|.:....|..|.:|...:.||||::.|.||.|.:||||.::.:||||.|:|.:||:
  Fly   195 PNGAYYAASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLLIPSASAYAK 259

  Fly   266 SAVFTL-GKTSETNGFWVHGLQYAFMKLAPMDIRTYFGYQLFKRM 309
            |||..| .:..||.|:..|.:|.|........:|||...:||.::
  Fly   260 SAVNQLRDEVDETPGYLWHHVQNAVATAFTWRVRTYVACKLFNKI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 137/301 (46%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 117/243 (48%)
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 119/247 (48%)
adh_short 51..243 CDD:278532 98/192 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439088
Domainoid 1 1.000 148 1.000 Domainoid score I2740
eggNOG 1 0.900 - - E1_COG0300
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D125652at50557
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 1 1.000 - - otm42934
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43899
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3003
98.850

Return to query results.
Submit another query.