DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and Wwox

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster


Alignment Length:290 Identity:60/290 - (20%)
Similarity:95/290 - (32%) Gaps:82/290 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQ---YNVKIKWIVADFAK 117
            |..|::|||..|||.|.||.||..|..::...|......|....|..:   ...:.::...|.:.
  Fly   121 GRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSS 185

  Fly   118 GREVYAHIEKELNGI-EVGILVNNVG--------TIHDPESLDKVSE----------DMLWDLLT 163
            .|.|...:|:....: .:..|:.|.|        |:...|:..:||.          :.|:|..|
  Fly   186 LRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLTLQLETLFDYKT 250

  Fly   164 ------------VNVGSVTMLTRKILP------QMISRRKGAIVNLGSSSELQP----------- 199
                        .|:....:....:.|      .|::.....:.|:..:.||..           
  Fly   251 RIIVLSSESHRFANLPVENLAVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRWKQRGISVFS 315

  Fly   200 -HP----------NLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQG 253
             ||          |...|......|..|||.|: :.|..:|:      ...|..:...|      
  Fly   316 LHPGNMVSSDLSRNYWFYRLLFAIVRPFTKSLQ-QAAATSIY------CATANELTGLS------ 367

  Fly   254 GLLFPNAY-----SYARSAVF--TLGKTSE 276
            ||.|.|.:     ..::||..  .|.|.||
  Fly   368 GLYFNNCFFCEPSKLSKSAALQQQLWKLSE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 60/290 (21%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 60/290 (21%)
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 60/290 (21%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 60/290 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447677
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.