DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and scu

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster


Alignment Length:250 Identity:60/250 - (24%)
Similarity:103/250 - (41%) Gaps:46/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYA 123
            ::|||...|:|:..|..||:||.:::|......|    .||:..:...|:.::..|....::|.|
  Fly     7 SLVTGGASGLGRATAERLAKQGASVILADLPSSK----GNEVAKELGDKVVFVPVDVTSEKDVSA 67

  Fly   124 HIE--KELNGIEVGILVNNVGT-------------IHDPESLDKVSEDMLWDLLTVNVGSVTMLT 173
            .::  |:..| .:.:.||..||             .|..|...:|.     ::.||...:|..|:
  Fly    68 ALQTAKDKFG-RLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVI-----NINTVGTFNVIRLS 126

  Fly   174 RKIL----PQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLV 234
            ..::    |....:| |.|||..|.:.........||:|:|..|...|..:..:::...|.:..:
  Fly   127 AGLMGANEPNQDGQR-GVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTI 190

  Fly   235 MPAFVATNM-NSYSDKVRQGGLLFPNAYSYARSAVF--TLGKTSETNGFWVHGLQ 286
            .|....|.| .:..:|||.         ..|:|..|  .||:.||    :.|.:|
  Fly   191 APGLFNTPMLAALPEKVRT---------FLAKSIPFPQRLGEPSE----YAHLVQ 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 59/249 (24%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 59/249 (24%)
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 59/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447627
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.