DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and hsd17b12a

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_957175.1 Gene:hsd17b12a / 327417 ZFINID:ZDB-GENE-030131-5628 Length:319 Species:Danio rerio


Alignment Length:321 Identity:125/321 - (38%)
Similarity:184/321 - (57%) Gaps:36/321 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LQVISTGIYIVGSLSIVAYLYENLKSLFSIIKSVVEPFFR------PNLPKTLAEKFGNWAVVTG 63
            ||.....::.||:| |.|.|     :|:.:.|::..  ||      .:|   |:.|.|.||||||
Zfish    10 LQPAERALFWVGAL-ITASL-----ALYVVYKTITG--FRIWVLGNGDL---LSPKLGKWAVVTG 63

  Fly    64 ATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYAHIEKE 128
            |||||||.||.||||:|.:::|:||.:|||..|...:.|.|.|:.|.|..||:: .:||..|||.
Zfish    64 ATDGIGKSYAEELARRGFSMMLISRSQEKLDDVAKSLESTYKVETKTIAVDFSQ-IDVYPKIEKG 127

  Fly   129 LNGIEVGILVNNVGT--------IHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRK 185
            |.|:|:||||||||.        :|.|:     .|:.:..::.||:.||..:||.:||:|.:|.|
Zfish   128 LAGLEIGILVNNVGISYSYPEFFLHIPD-----LENFITTMINVNITSVCQMTRLVLPRMEARAK 187

  Fly   186 GAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKV 250
            |.|:|:.|:|.:.|.|.||.|::||.||..|::||:.|.....|.:|.|:|.||||.|.    |:
Zfish   188 GVILNISSASGMFPVPLLTIYSSTKAFVDFFSRGLQTEYKCKGIIIQSVLPFFVATKMT----KI 248

  Fly   251 RQGGLLFPNAYSYARSAVFTLGKTSETNGFWVHGLQ-YAFMKLAPMDIRTYFGYQLFKRMR 310
            |:..|..|....|..:.:.|:|...:|||::.|.:. :....|||:|:....|.::.|..|
Zfish   249 RKPTLDKPTPERYVAAELNTVGLQDQTNGYFPHAVMGWVTTILAPIDLVLNLGLRMNKAQR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 122/312 (39%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 106/249 (43%)
hsd17b12aNP_957175.1 PLN02780 18..310 CDD:166421 123/313 (39%)
17beta-HSD1_like_SDR_c 56..288 CDD:187614 103/241 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100431
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.