DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and CG31548

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster


Alignment Length:213 Identity:57/213 - (26%)
Similarity:104/213 - (48%) Gaps:16/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GNWAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAK--- 117
            |...::|||:.|||...|.:.|:.|..|.|..|..|.|..|..|.......:...:|.|.||   
  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEAD 69

  Fly   118 GREVYAHIEKELNGIEVGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMIS 182
            .:.:::...::...::|  ||||.|.| :..:::..|.:....::..|:.::..||....|::: 
  Fly    70 TQRIWSETLQQYGKLDV--LVNNAGII-ETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELV- 130

  Fly   183 RRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYS 247
            :.||.|||:.|.:.::..|.:.||..:|..|..||:.:..|:|...:.|..|.|....||:::  
  Fly   131 KTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHA-- 193

  Fly   248 DKVRQGGLLFPNAYSYAR 265
                :||:   :|.:|.:
  Fly   194 ----RGGM---DAETYKK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 57/213 (27%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 57/213 (27%)
CG31548NP_730974.1 fabG 1..250 CDD:235975 57/213 (27%)
NADB_Rossmann 3..253 CDD:304358 57/213 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.