DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and R05D8.7

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_503751.1 Gene:R05D8.7 / 187608 WormBaseID:WBGene00019885 Length:280 Species:Caenorhabditis elegans


Alignment Length:217 Identity:58/217 - (26%)
Similarity:104/217 - (47%) Gaps:15/217 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KFGN-WAVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNV---KIKWIVAD 114
            :|.| ..::||:::|||:..|...|::|.|:.:..|..|:| ..|.:|..:..|   ::..:|||
 Worm     3 RFSNKTVIITGSSNGIGRTTAILFAQEGANVTITGRSSERL-EETRQIILKSGVSEKQVNSVVAD 66

  Fly   115 FA--KGREVYAHIEKELNGIEVGILVNNVGTIHDPESLDKVSEDMLWDL----LTVNVGSVTMLT 173
            ..  .|::...:...:..| ::.:||||.|.. .|::......|...|:    |.:|:.:|..:|
 Worm    67 VTTEDGQDQIINSTLKQFG-KIDVLVNNAGAA-IPDAFGTTGTDQGIDIYHKTLKLNLQAVIEMT 129

  Fly   174 RKILPQMISRRKGAIVNLGS-SSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPA 237
            :|:.|.::: .||.|||:.| .:..|..|:...||..|..:..:|:....::|:..|.|..|.|.
 Worm   130 KKVKPHLVA-SKGEIVNVSSIVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPG 193

  Fly   238 FVATNMNSYSDKVRQGGLLFPN 259
            .|.|...:......|....|.|
 Worm   194 MVETGFTNAMGMPDQASQKFYN 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 58/217 (27%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 57/215 (27%)
R05D8.7NP_503751.1 FabG 3..261 CDD:223959 58/217 (27%)
SDR_c11 4..265 CDD:187622 58/216 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.