DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and C06E4.6

DIOPT Version :10

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_501154.1 Gene:C06E4.6 / 182329 WormBaseID:WBGene00015535 Length:274 Species:Caenorhabditis elegans


Alignment Length:37 Identity:8/37 - (21%)
Similarity:18/37 - (48%) Gaps:4/37 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 IC----ITTTIILLASSNWDRNVIPYARWVGFTAMVL 108
            ||    :|..||.:.:.:.::.::......|.|.:|:
 Worm    27 ICRQMQVTAEIIYIETDSVEKGILQLISQRGVTKLVM 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 17beta-HSD1_like_SDR_c 56..297 CDD:187614 8/37 (22%)
C06E4.6NP_501154.1 Rossmann-fold NAD(P)(+)-binding proteins 4..266 CDD:473865 8/37 (22%)

Return to query results.
Submit another query.