DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and stdh-1

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_506449.1 Gene:stdh-1 / 182291 WormBaseID:WBGene00007363 Length:314 Species:Caenorhabditis elegans


Alignment Length:296 Identity:103/296 - (34%)
Similarity:165/296 - (55%) Gaps:18/296 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LQVISTGIYIVGSLSIVAYLYENLKSLFSIIKSVVEPFFRPNLPKTLAEKFG-NWAVVTGATDGI 68
            ::..:||   ||::.::..||..::...:|:...|  |.:   |..|.:|.| :|||||||||||
 Worm     3 IEWFATG---VGAVVVLYILYHFIRITLNILGPYV--FCQ---PIDLKKKAGASWAVVTGATDGI 59

  Fly    69 GKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQY-NVKIKWIVADFAK-GREVYAHIEKELNG 131
            ||.|:.|||::|.|:.:|||.:.||.....||...: ::::::...||.. ....|..:..:||.
 Worm    60 GKSYSFELAKRGFNVYIVSRTQSKLEHTKKEILEVHPDIEVRFATFDFTNPSVSDYEKLLSKLNE 124

  Fly   132 IEVGILVNNVGTIHD-PESLDKVSE--DMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGS 193
            :.:|||:||||...| ||.|.|::.  |.:.::..:|....|:|:..|||||:.|:.|.|||:||
 Worm   125 VSIGILINNVGMFFDYPEMLHKINGGIDSIANVTIINTLPATLLSAGILPQMVPRKAGIIVNIGS 189

  Fly   194 SSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFP 258
            .:.|......:.|:||||:|...|..|:.|.....|..|.:.||.|||.|....:.    ....|
 Worm   190 VAGLATMAEWSVYSATKKYVEWITGCLQKEYGHQGIIFQAITPAMVATKMAGNPNT----SFFTP 250

  Fly   259 NAYSYARSAVFTLGKTSETNGFWVHGLQYAFMKLAP 294
            ::.::|:||:.|:|..|:|.|:..|.::...:||.|
 Worm   251 DSDTFAKSALNTIGHASQTTGYITHQIECEMLKLLP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 101/289 (35%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 91/245 (37%)
stdh-1NP_506449.1 17beta-HSD1_like_SDR_c 47..289 CDD:187614 90/244 (37%)
adh_short 49..242 CDD:278532 77/192 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I2740
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100431
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.690

Return to query results.
Submit another query.