DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31810 and let-767

DIOPT Version :9

Sequence 1:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001293606.1 Gene:let-767 / 175895 WormBaseID:WBGene00002891 Length:337 Species:Caenorhabditis elegans


Alignment Length:300 Identity:113/300 - (37%)
Similarity:169/300 - (56%) Gaps:25/300 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YIVG----SLSIVAYLYENLKSLFSIIKSVVEPFFRPNLPKTLAEKFG-NWAVVTGATDGIGKEY 72
            ::||    :|:.|||      .|.:|..:::.|:...: |..|.::.| :|||||||||||||.|
 Worm    23 FLVGAGYVALAAVAY------RLLTIFSNILGPYVLLS-PIDLKKRAGASWAVVTGATDGIGKAY 80

  Fly    73 ARELARQGLNLVLVSRKEEKLIAVTNEIGSQY-NVKIKWIVADFAKGR-EVYAHIEKELNGIEVG 135
            |.||||:|.|::||||.:.||.....||..:| :::::....||.... ..|..:...||.:|:|
 Worm    81 AFELARRGFNVLLVSRTQSKLDETKKEILEKYSSIEVRTAAFDFTNAAPSAYKDLLATLNQVEIG 145

  Fly   136 ILVNNVGTIHD-PESLDKVSE--DMLWDLLTVNVGS----VTMLTRKILPQMISRRKGAIVNLGS 193
            :|:||||..:: |:.|.||..  :.|.::.|:|...    :|.|:..|||||::|:.|.|||:||
 Worm   146 VLINNVGMSYEYPDVLHKVDGGIERLANITTINTLPPTLFLTQLSAGILPQMVARKAGVIVNVGS 210

  Fly   194 SSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQGGLLFP 258
            |:..........|:||||:|:..|..|..|.....|.||.:.|..|||.|:    ||::.....|
 Worm   211 SAGANQMALWAVYSATKKYVSWLTAILRKEYEHQGITVQTIAPMMVATKMS----KVKRTSFFTP 271

  Fly   259 NAYSYARSAVFTLGKTSETNGFWVHGLQYAFMKLAPMDIR 298
            :...:|:||:.|:|.||:|.|:..|.||...|.|.|..||
 Worm   272 DGAVFAKSALNTVGNTSDTTGYITHQLQLELMDLIPTFIR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 112/299 (37%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 100/250 (40%)
let-767NP_001293606.1 17beta-HSD1_like_SDR_c 64..310 CDD:187614 99/249 (40%)
adh_short 66..265 CDD:278532 83/202 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I2740
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53762
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100431
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.